SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004271 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004271
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily vWA-like 9.74e-53
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 236-358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000738
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 194-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 369-409
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000034
Family Chicken cartilage matrix protein 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004271   Gene: ENSCPOG00000004739   Transcript: ENSCPOT00000004789
Sequence length 413
Comment pep:known scaffold:cavPor3:scaffold_18:2587453:2605352:-1 gene:ENSCPOG00000004739 transcript:ENSCPOT00000004789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGICKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSQIIDTLDIGAAATRVALVNYASTVKI
EFQLQTYADKQALKKAVARITPLSTGTMSGLAIQTAMDEAFTVQAGARGPTANIPKVAII
VTDGRPQDQVSEVAARARASGIELYAVGVDRADMESLKTMASEPLGEHVFYVETYGVIEK
LSSRFQETFCALDPCLLGTHQCQHVCVSDGDGRHHCECSQGYTLNSDQRTCAAVNKCALN
THGCEHLCVDEGTGSYHCECYEGHTLNEDKKSCSAQDKCASGTHGCQHICVKDGPGSHHC
ECFEGYTLNADKKTCTVRNKCALGTHGCQHICVSDGAASYHCDCFPGYSLNEDKKTCAAV
EEVRRLVSTEDACGCEASLAFQDKVSSYLQRLNTKLDDILEKLQVHESRQIHR
Download sequence
Identical sequences ENSCPOP00000004271 10141.ENSCPOP00000004271 ENSCPOP00000004271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]