SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004314 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004314
Domain Number 1 Region: 855-936
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-21
Family DEATH domain, DD 0.00000906
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000467
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000103
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000054
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004314   Gene: ENSCPOG00000004794   Transcript: ENSCPOT00000004845
Sequence length 945
Comment pep:known scaffold:cavPor3:scaffold_15:20423594:20501951:1 gene:ENSCPOG00000004794 transcript:ENSCPOT00000004845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVRSGARGALLLALLLCWNPRLSQAGADAGSEVLPDSLPSVPEEPLPHFLLEPQDAYIV
KNRPVELHCRASPATQIYFKCNGEWVGQSDHVTQEGRDEATGLRVRDVQIQVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSHRAYVRIAYLRKNFDQEPLGKEVPLDHELLLQCRPPEGV
PVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWTEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCIGPLLDSKNCTDGLCMQNKRTL
SDPKSHLLESSGDVALYAGLVVAIFVVVAVLLAVGVVVYRRNCRDMDTDITDSSAALTGG
FHPVNFKTSRPGNPQLLHPSMPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPGL
KIKVYNSSTTGPRPGLPDGTDLLGVLPPGTYPGDLSRDSHFLHLRSASLGSQQLLGLPRE
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPISEGTQTV
LSPSVTCGPTGLLLCRPVILTVPHCAEVSAGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEARSCHILLDQLGTYVFTGESYSHSAIKRLQLAIFAPALCTSLEYNLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFC
HIWSGSQKALHCTFSLERHSLASSELTCKICVRQVEGEGQIFQLHTTLAETPASSLDALC
SAPSSTITTQLGPYAFKIPASIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
Download sequence
Identical sequences H0V3Z1
10141.ENSCPOP00000004314 ENSCPOP00000004314 XP_003473815.1.53824 ENSCPOP00000004314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]