SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004452 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004452
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000122
Family Caspase recruitment domain, CARD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004452   Gene: ENSCPOG00000004946   Transcript: ENSCPOT00000004999
Sequence length 184
Comment pep:novel scaffold:cavPor3:scaffold_22:9408386:9409334:-1 gene:ENSCPOG00000004946 transcript:ENSCPOT00000004999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVQERPSEIIDRERKRLVETLQADSGLLLDALVARGLLTGPEYEALDALPDGERRIRR
LLLLVQSKGEAACQELLRCAQQTVHTPDPLWDWKHVGPGYRDRSYDPPCPGHWTPEAPSS
GTAYPGLPRASDNEEARDPEGSGAVQPEIAEEPDLEAEASEEGDESEGRSADLSFSPQPK
PDRQ
Download sequence
Identical sequences ENSCPOP00000004452 ENSCPOP00000004452 10141.ENSCPOP00000004452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]