SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004479 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004479
Domain Number 1 Region: 29-313
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.07e-47
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 405-540
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000513
Family WD40-repeat 0.036
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004479
Domain Number - Region: 772-932
Classification Level Classification E-value
Superfamily ARM repeat 0.00921
Family Clathrin heavy-chain linker domain 0.051
Further Details:      
 
Domain Number - Region: 651-697
Classification Level Classification E-value
Superfamily HCP-like 0.0641
Family HCP-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004479   Gene: ENSCPOG00000004975   Transcript: ENSCPOT00000005029
Sequence length 1203
Comment pep:novel scaffold:cavPor3:scaffold_109:2793353:2843816:1 gene:ENSCPOG00000004975 transcript:ENSCPOT00000005029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLAWRLLLRREGGGRSIAKAAMRAVLTWRDKVEQCIYDLAFKPDGTQLIVAAGNRLLVYE
TSDGTLIQPLKGHKDTVYCVAYAKDGKRFASGSADKSVIIWTSKLEGILKYSHNDSIQCV
SYNPITHQLASCSSSDFGLWSPEQKSVNKHKASSKVTCCSWTNDGQYLAVGMMNGVISIH
NKNGEEKVKIERPGGSLSPIWSICWNPSREEHNDILAVADWGQKLSFYQLSGKQVGKDRL
LNFDPCCISYFSKGEYILLGGSDRQVSLFTKDGVRLGTIGEQNSWVWTCREKPDSNYVVT
GCQDGTIAFYHLIFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYK
NRLAIQLPEKILIYELYSDDLSDMRYRLKEKILKKFECNLLVVCTNHIVLCQEKRLQCLS
FSGGKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQILKIFVDSLFAIVLLKQATAVR
CLDISAYRNKLAVVDENDTCLVYDIHTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNI
KASNFPVHQRKLQGFVVGYNGSKIFCLHAFAMSAVEVPQSAPMYQYLDRKMFREAHQIAC
LGVTEADWRELAMEALEGLEFETAKKAFARVQDLRYLELISSIEERKKRGETNSDLFLAD
VFSYQGKFHEAAKLYKRCGREDLALAMYTDLRMFEYAKDFLGSGDPKETKMLITKQADWA
RNINEPKAAVEMYLSAGEHIKAVEISGDLGWVDMLIDIARKLDKAEREPLLLCARYFKEL
DSPGYAAETYLKLGDLKALVQLHVETQRWDEAFALGEKHPEFKDDIYVPYAQWLAENDRF
EEAQKAFHKAGRQGEAVQVLEQLTHNAVVENRFSDAAYYYWMLSMQCLEIAQADPTQKDA
MLDKFHHFQHLAELYHGYHAIHRFTEEPFSSHLPETLFNISRFLLNSLTKDTPPGISKVN
TLYTLAKQSKALGAYKLAWYAYDKLQGLRIPAKFQKSIELGSLTIRSKPFHDSEELVPLC
YRCSTNNPLLNSLGNVCVNCRQPFIFSASSYEVLHLVEFQLEEGISDEEAVALIDLEAPR
HQREDRWQEVASGDSQTLRLDETMNPSGDDPFTAKLSFEQGGSEFVPVVVGRAVLRSMSR
RDVLVKRWPPPLRWQYFRSLLPDAAITMCPSCFQMFHSEDYELLVLQHSCCPYCRRRIDD
RAR
Download sequence
Identical sequences 10141.ENSCPOP00000004479 ENSCPOP00000004479 ENSCPOP00000004479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]