SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004518 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004518
Domain Number 1 Region: 161-462
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-58
Family Protein kinases, catalytic subunit 0.00051
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily DEATH domain 1.31e-23
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004518   Gene: ENSCPOG00000005020   Transcript: ENSCPOT00000005074
Sequence length 603
Comment pep:known scaffold:cavPor3:scaffold_9:32316324:32363716:-1 gene:ENSCPOG00000005020 transcript:ENSCPOT00000005074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSGALSAHTLLFDLPPTLLGELCAVLDSCDSRFKYRDIATERLSNSWLDVRHIEKYVD
QGKSGTRELLWSWAQKNKTIGDLLQILEDMGHYRAIHLITEHGTGTHPLKQSRQEYGFPN
ILDKVGHVCIENDLGCWETANATVDNILTPKHNGKGMLPESSISFQNIIEGTRNFHRNFL
IGEGEIFEVYKAEIRDQTYAIKLFKQEKKLQYKKHLKKFLSEIEVFLLFHHPNILELAAY
FAETEKFCLVYPYMRNGTLFDRLQCVGNTAPLSWHIRISILIGVSKAVWYLHSTQPCSVI
CGSISSANILLDDQFQPKLTDFAMAHFRHHLEKQTSTINMTSSSSKHLWYMPEEYIRQGK
LSTKTDIYSFGIVIMEVLTGCKVVLDDPKHVQLRDLLMELMKKRGLDSCMSFVDKKVHPC
PRNFSAKLFSLASQCAATRAKLRPSMDEVLNVLESTQASLYFAEDPPTSLKSFRCLSPVF
LDNIPSIPVEDDESQNNHSPPHDKSLRKDRTPNIPFECSQSEVTFLGLDRKTRSKRNEDA
CDMPHFPCKESWSSKHTASSQDLQPTEVSLDSSFEASTYRSRPAKTRCSSEIFWSKHEQC
QKE
Download sequence
Identical sequences ENSCPOP00000004518 ENSCPOP00000004518 10141.ENSCPOP00000004518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]