SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004575 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004575
Domain Number 1 Region: 112-189,289-355,390-535
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.04e-85
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000638
Further Details:      
 
Domain Number 2 Region: 25-78
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000143
Family Glutathione S-transferase (GST), C-terminal domain 0.028
Further Details:      
 
Domain Number 3 Region: 572-717
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000000049
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.006
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004575
Domain Number - Region: 203-254
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0549
Family Apolipoprotein A-I 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004575   Gene: ENSCPOG00000005087   Transcript: ENSCPOT00000005142
Sequence length 831
Comment pep:known scaffold:cavPor3:scaffold_42:11593232:11639696:1 gene:ENSCPOG00000005087 transcript:ENSCPOT00000005142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPVPSVFSAADYRSILSISDEAARVQALDQHLSTRSYIQGYSLSQADVDVFRQLSTPPAD
TRLFHVTRWFRHIEALLGGPRDKGEPCGLQASKGRRVQPQWSPPAGTEPCKLRLYNSLTR
NKDVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLKDYFQYDVFYCMNITD
IDDKIIRRARQNYLFEQYRDRKPPASQLLEDVHAALKPFTEKLHETTDPDKRQMLERIQH
AVELATEPLERAVHASLPGEEVDSLAQVLMEEAKDLLSDWLDSTCGSEVTDNSIFYKLPK
FWEEEFHKDMEALNVLPPDVLTRVSEYVPEIVDFVQKIVDNGYGYASNGSVYFDTVKFAS
SEKHSYGKLVPEAVGDQKALQEGEGDLSVSADRLSEKRSPNDFALWKASKPGEPSWPCPW
GKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHT
GHLTIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEK
FMNEFFLNVKDILRAPVDITGQFEKWEDEEAELNKNFYDKKMAVHKALCDNVDTRTVMEE
MRSLVSQCNLYMAARKAARRRPNRALLESVALYLTHMLKIFGAIEEESSLGFPIGGSGTS
LNLESTVMPYLQVLSEFREGVRKIAREKKVPEVLQLSDTLRDDILPELGVRFEDHEGLPT
VVKLVDRDTLLKEREEKKRVSKIKTVELDFAGNEKQSALAAKLAKMKIPPSEMFLSESDK
YSKFDENGLPTHDTEGKELSKGQAKKLKKLFEAQEKLHKDYLQMVQNGSLQ
Download sequence
Identical sequences ENSCPOP00000004575 10141.ENSCPOP00000004575 ENSCPOP00000004575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]