SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004580 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004580
Domain Number 1 Region: 3-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-73
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1494-1687
Classification Level Classification E-value
Superfamily Plakin repeat 2.49e-47
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 1692-1875
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-36
Family Plakin repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 6120-6237
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 216-332
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-27
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 6540-6674
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-26
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 5966-6125
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-25
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 8 Region: 6294-6457
Classification Level Classification E-value
Superfamily Spectrin repeat 2.82e-25
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 9 Region: 4431-4591
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-22
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 5636-5794
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-22
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 11 Region: 6670-6785
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-21
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 4763-4918
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-21
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 13 Region: 5201-5358
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 14 Region: 7032-7111
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.41e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 15 Region: 6735-6861,6892-6923
Classification Level Classification E-value
Superfamily Spectrin repeat 6.53e-20
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 16 Region: 3983-4122
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-20
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 17 Region: 6460-6569
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 18 Region: 5353-5470
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-19
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 19 Region: 5528-5675
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-18
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 20 Region: 650-752
Classification Level Classification E-value
Superfamily Spectrin repeat 7.05e-16
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 21 Region: 1196-1312,1339-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 22 Region: 6943-7023
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000143
Family Polcalcin 0.044
Further Details:      
 
Domain Number 23 Region: 4977-5137
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000228
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 24 Region: 4651-4774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000168
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 25 Region: 5792-5905
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000259
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 3727-3848
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000339
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 27 Region: 3900-4013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 28 Region: 4178-4300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000432
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 4338-4448
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000468
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 557-648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000471
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 31 Region: 731-831,952-972
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000781
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004580
Domain Number - Region: 3245-3339
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00137
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 970-1119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00345
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 3493-3608
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0681
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number - Region: 1087-1189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0791
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004580   Gene: ENSCPOG00000005092   Transcript: ENSCPOT00000005147
Sequence length 7328
Comment pep:novel scaffold:cavPor3:scaffold_0:86179782:86412870:1 gene:ENSCPOG00000005092 transcript:ENSCPOT00000005147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLV
NIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGV
RCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPE
DVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHV
TTMSERTFPTNPIEIKALYNQYLQFKETEIPPKETEKSKIKRLYKLLENWIEFGRIKLLQ
GYHPNDIEKEWGKLIVAMLERDKALRPEVERLEMLQQIASRVQRDTVVCEDKLMLARSAL
QSDSKRLESGVQFQNEAEIAEYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRD
DIMALRNECSSVYSKGRMLTAEQTKLMISGISQSLNSGFAQTLTPTLNSGLTASVTHSLT
SSGVTSGLSSGLTSHLTPSVTPAYTPGFPSGFIPNFSPGGDPSSLQSLKLMQIRKPLLKS
SLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDHTEWGSDLPSVESHLENHKNVHRAIEEF
ESSLKEAKISEIQMTAPLKLTYTEKLHRLESQYAKLLSTSRNQERHLDTLHNFVSRATNE
LIWLNEKEEEEVAYDWSERNTHIARKKDYHAELMRELEQKEENIKSVQEIAEQLLLENHP
ARLTIEAYKAAMQTQWSWVLQLCQCVEQHIKENTAYLEFFSDAKEATDYLKNLKDAIQRK
YSCDRSSSIHKLEDLVQESMEKEELLQYKSTVASLMGRAKTIIQLKPRNPDYPLKTSIPI
MAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFA
NRIEQQYQNVLALWHESHINMKSVVSWHNLINEIDGVRASNVASIKTMLPGEHQQVLSNL
QSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESIYNLYISEV
RNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELEQLKDDLGSITNKCEE
FFSQAAASPSMPTLRSELSTVVQNMNHIYSMSSTCIEKLKTVNLVLKNTQAAEALVKLYE
TKLCEEEAVIADKNNIENLISTLKQWRSEVDAKREVFHALEDELQKAKAISDEMFKMYKE
RDLDFDWHKEKADQLVERWQNVHMQIDNRLRELESIGKSLKYYRDTYHPLDDWIQQVETT
QRKIQENQPENSKALATQLNQQKMLVSEIEMKQNKMDECQKYAEQYSAAVKDYELQTMTY
RAMVDSQQKSPVKRRRMQSSADVIIQEFMDLRSRYTALVTLMTQYIKFASDSLKRLEEEE
KLLEEEKKEHVEKAKELQKWVSNITKTLDGAKAGKSPFSRQKISSEELSIKKEQLSEALQ
TMQLFLAKHGDKMTDEERNELEKQVKTLQEGYNLLFSECLKQLEESQTSGDTNVEEKLDK
VIAGTIDQTTGEVLSVFQAVLKGLIDYDTGIRLLETQLLISGLISPELGKCFDLKDAKSH
GLIDEQILCQLKELNKAKEIISVSSSNKIPVLDALDQGLISESMAIKVLEILFSTGFLVI
PATGEHLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDPFTSEKVSLTDMVQRSILQENT
GMWLLPVRPQEGGRITLKCGRSISILRAAHEGLIDRETMFRLLGAQLLSGGLIECTSGHK
LTVEEALAEGVIDGNTAHGILTHQVQTGGIICSNPAKRLTMDEAVQCNLITSSSALLILE
AQRGYVGLIWPHSGEIFPTSSSLQQKLITNELAHKILNGRQKIAALYIPESSQVIGLDVA
EQIGIIDNNTALILKNIVLPDKMPDLGDLEACKNTRRWLSFCKFQPSTVHDYRQEEDSFE
GEEPGAAQSSEQTKKLFLSYLMVNSYMDANTGQRLLLYDEGLEEAIGMLLDSCSAEFGED
AAVKDSLDVIGVPGLFLHSAASKGKTECMASSANSDKSHCRESGHGETCEDQKDVPIEKR
NGKVGNNAISSEFYQSENLIVTDEEVNTSFSMCIPSPVPCVKQTEPKEASTLGHDSENRL
KNCENQSQPETNEHADECSHSKNIQNFANDLISRPVVKSETDRFCDVTETKNEDNIKQDS
CSFDYSPRLSTLLRHDRLRHSQKSFNDVCSLENDGNPCEASSLSLSDQNMLPNQRMGENF
QDQFLGIAAINITLQGETSVMKSLNSACSPPQIQSCSDEYVSDTLTENEEMHTASQWTPA
GKQNESETEDFSCANSTNTSWICGSPVLQKAISACDYETSPLDDQQSDTETDTNSDNDFY
DTLLFEDDDHDSLLLEGNIQDCLQPEEYDTLQEENEGMVSPVDVFYDISKGNESPEVPWG
GLVGNFSLRNESQCLEGFLIGTEKAELDASNRKHLSSFGSEKVNEWAVGTSSERKHTDDL
EGGMSDSLTNYEIVGREGSSGDSLEFDDTGSWRRKEYITGQPDINHFDSMQNEESYRDYM
GGEAVGNDNGKSEDNQLCVIAVKKNNDKNQSIKMLVSDKMHNYSSLERQQSVSVLQLESI
SKSNLVTDRNHLQEHTTGVVQQSEENMLTHETVLRGTLLPNTEDSESDTKIKMIQGPESV
SLENVATKINPSFDKAIGAQPVVKGKPTDNQLLFTASMTARDDQGPGRGQGKAGTVSVLT
EGSGSAQKMCLGEEVLIEDPEEENKYLKHPLNKSTKESLNLIKSQCPFPQIMNSEDGDHR
GSPEKATGALKEEPKAAQTVSSRSPVQFEDLEEIFQMSVSKVINDDATSDVVLLEGNATT
VKESFTSRPGNERDLLAFLKHNAKGIKAKDVLKPNEDTPQVLIADSPRREDLQLGENNAK
ENLVPTQECWPLNKILQHNDVIIKESVSEGGTKIDHCTAENSEIVLPSLTLKDVEDIGVK
TDHMKSEVCVNEIKNDNSANTLDTEYSFLKIDHEKEGIEKQPLKQQNLSLEHQEKVTQIV
ELSQVFVRNIKDILKNKLKNNLNPQEVADPSAYVDPETSIINLIKQISSSQLISETSNVS
FNSSISDGPGVPPVNDSAELRDNINSEHLLDILNPNPHSPRITGVFNLMRELTKLQYDLE
QRGISSKVPLVKLEKAFYKLLTDRYSEKGEQVRDLSQKLCTTPEIVDEKPHIVSDHKSKE
GNHSSPNLQTMKERQLESPVGCGLELPRDKRPEDLCSDFLNHLACVAGSKEMTYGDSPGE
KFSSELQQCSQHTEKMHEYLAFLQDMKPPIDNQESVGNSLEALRNQLKQLEIFDLRLSPI
AVILKKDIKLAEDFSKSLPSDFPRSYLEELNMSHQSLQTAFSSLSSVFSEKMKQIMLAID
SEMSKLEVSCEEFLHKLTSFSEWISERSRSVKDTEALKAEDTEHVKKNLEFLKTVLKDLG
HTKMQLEMTAFDVQFFISEYAQDLSPNQSRQLLRLLNATQKSFLDVQESVTMQVERLEMQ
LQLERDLDDQKTVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFVIGDGTAELKKFRTE
QEELQKDMQRSTQALEEVVRNTENFLKENGEKLSQDDKALIEKKLSEAKIKCEQLNLKTE
QSKKELDKVVKTAIKEETEKVAAEKQLEESKTKIENLLDWLSNINNDSERAGTEHKQLIE
QNGTHFDEGDGRLETGEEDDENGNLSAVDVSERDGGPEDNLNQQYQKIKAQHEKIISQHQ
AVIIATQSAQSLLEKQGHYLSPEEKEKLQKNMKELKAHYETTLAESEKKMKLTHTLQEEF
EKFDADYGEFEHWLQQSEQELENLAVGVDNLGGLLSMLSRQKSFSEDVISHKGDLRYITI
SGNRVLEAAKLCSKREGSKAPEADVDTSATHREVQNKLSHATDRFRSLYSKCNVFGNNLK
DLVDKYQHYEDASCTLLSALQAAESLASKHLLEPIAVDPQNLQRQLEETKALQGQISSQQ
LAVEKLKKAAEVLLDARGSLFSAKKDIQKTLDDIVGRYDDLSKSVHERHEKLQITLTRSL
SVQDGLDEMLNWLGGVESSLKEQGQVPLNSAALQDLISKNIMLEQDIAGRQSSVNAINEK
VKKFIERADPSTASSLQARMKELSVRFSEASQKHREKLAKMEELKTKVELFESLSEKLQT
FLETKTQALTEADVPGKDVTELSQYMQESTSEFLERKEDLDALHNLLKDISSHGLPGDKA
LVFEKTNNLSKKFKEMEDTIKEKKEAATSCQEQLEAFQILVKSLKSWIKETTEQVPILEP
SFGAEDLGKSLAETKKLQEKWSLKTPEIQKVNSNGISLCNLISAVTTPARAIAAVKSGGV
MLNGKGTDINTQDFLTNKGLTSVQKDMTDISHSYEDLGLLLKDKIAELNTKLFKLQKAQE
ESSSMMQWLEKMNKTAAKWHQTPTPADTEAVKTQFEQNKSFEAELKQNVNKVQELKDKLT
ELLEENPDIPEAQKWNQILKEIDAKWQELNQLTVDRQQKLEESSNNLTQFQTVKAQLKQW
LVEKELMVSVLGPLSIDPNMLNTQKQQVQILLQEFDTRRPQYEQLRAAGQGMLSRPGEEP
TLHGVVKEQLAAVTQKWDSLTGQLSDRCDRINQGIVQSMQYQSLLRSLSERLNELEKRLS
DSLTASTPADAVTQQLEIAWRLKQEVEQEAPQIKAAQALCAGLSTLVREEYLKAELSRQL
DSILKSFKDIEQKAENLVQHLQSACASSHQFQQMSKDFQAWLDTKKEEQKKSHPVSASLK
VLESLIKDQKDFSTTLAAQSNIYEKTIAEGENLLLKTQGSEKAALQLQLNMIKNNWDGFN
KQVKERENKLIDAFKKALKYKEQVETLRPWIDKCQNKLEEVKFCLDPAEIENSISKLKSL
QKEMDQHFGMVELLNNTANSLLSVCEVDREVVTDENKALIQKVNTISEQLHSKKFSLENT
ARKFKEFEEVSKEANRQLQCAKEQLDVHESLGPQAYSNKWLTILQAQQKALQTLMHQVDL
ARRLAQDLVIEAADSKGTSDILLQAETLAQAHSTLSQQVDEKCSFLETKLQGIGHFQNTI
REMFSQFAEFDDELDSMAPVGRDVETLHMQKEAIKTFLKKLGALIASNDNANKTCKMMLA
TEEASPDLTGIKRDLEALSKQCNKLLDRAHAREEQVEIMLESLKEFYSKFEEFSTLLQKA
EEHEESQDPVGMEIETLNQQLAVFKVFQKEKIEPLQVKQQDVNWLGQGLIQSAAKNTSTQ
GLEHDLEDVSARWKTLNKKVVAQRAAQLQEALLHCGRFQDALESLLSWMADTEELVANQK
PPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIAAMAEPADKVKILEQLSLLG
SRWETLLNKVEARNRQLEGILVVAQQFHETLEQLNEWLTTIEKRLANSDPIGTQASKLEE
QIAQHKILQEDILLRKQNVDQAILNGLELLKHTTGDEVLIIQDKLEAIKARHKDVLKLST
DVAVTLEQALELSKRLYSIQEQLCNWLDKVEAELLSYETQALKGEAASQAHRRQKELKQE
LKNNKALLDSLNEVSSSLQELVPWRAREGLGKMVAENNERYRLVSNTIAQRVEEMDAAVL
RSQQFHQAADAELSWITETEKKLLSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDMIDEL
VKSEDKIMAISSEEEKQSVKNKLDKVLKNYDTICQINSERYLQLERAQSLISQFWETYEE
LWPWLIETQRIILQLPTPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELS
PGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAMSQSTQFHNKIDQIRESLERIVERL
RQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKLRGEEMIARSGGTDKDISAKAV
RDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMALVVTTKDTQDLIQDLEEPG
IDPSVVKQQQEAAEAIKEEIDGLQEELDAVINLGSELIAACGEPDKPIVKKSIDELNSAW
DSLNKAWKDRIDQLEEAMQTAVQYQDGLQAVFDWVDIADGKLASMSPIGTDLETVKQQIE
ELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLVELKLIWDSLDERIVTR
QHKLEGALLALGQFQHALDELLTWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVL
AHQSTVEAVNKAGNDLVESSAGEEASNLQHKLEVLNQRWQNVLEKTEQRKQQLDGALRQA
KGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEICAVFDVKEETYRSLMQ
KGQQMLARCPKSAETNVDQDINNLKEKWESVETKLTERKTKLEEALSLAVQFHDSLQDFI
SWLTQAEQTLNVASWPSLILDTVLFQIDEHRGGGKVFANEVNSHREQIIELDKTGTHLKY
FSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESE
KSLDSDMEIANDPDRIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTCLADDNLKL
DDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVH
GDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSSDDSSWVKVQMQELSTRWE
TICALSISKQTRLEAALHQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDVLRTLIDQ
HKEFMKKLEEKRADLNKATSMGDAVLAMCHPDSITTIKHWITIIRARFEEVLAWAKQHQQ
RLASALAGLIAKKELLEALLAWLQWAETTLNEKDKEDIPQEIEEVKALIAEHQSFMEEMT
RKQPDVDKVTKTYKRRVADPPSLQSHIPVLDKGRAGRKRFPASGLYPSGSQAQIETKNPR
VNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMD
FFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHP
NKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRI
LRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMEL
REKFILADGASQGMTPFRPRGRRSRPSSRGASPNRSISVSSQAAQGASPQVPATGTPKGT
PIQGSKLRLPGYLSGKGFHSGEDSGLITTAASRVRTQFADARRTPSRPGSRAGSKAGSRA
SSRRGSDASDFDISEIQSVCSDVEPVPQTHRPAPRASPRPARGTGKPSKIPMPQRRLPAS
RLDKSSKR
Download sequence
Identical sequences 10141.ENSCPOP00000004580 ENSCPOP00000004580 ENSCPOP00000004580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]