SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004591 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004591
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.3e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 201-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.11e-21
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004591   Gene: ENSCPOG00000005103   Transcript: ENSCPOT00000005158
Sequence length 281
Comment pep:known scaffold:cavPor3:scaffold_18:8880389:8883816:1 gene:ENSCPOG00000005103 transcript:ENSCPOT00000005158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNIQTSGRLSNVAP
PCILRKNPPSARNGGHETDTQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVIAGIISILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences H0V4P0
ENSCPOP00000004591 ENSCPOP00000004591 XP_003472944.1.53824 10141.ENSCPOP00000004591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]