SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004661 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004661
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily DEATH domain 4.14e-18
Family Caspase recruitment domain, CARD 0.018
Further Details:      
 
Domain Number 2 Region: 583-664
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000125
Family PDZ domain 0.028
Further Details:      
 
Domain Number 3 Region: 856-997
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000026
Family Nucleotide and nucleoside kinases 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004661   Gene: ENSCPOG00000005182   Transcript: ENSCPOT00000005237
Sequence length 1001
Comment pep:known scaffold:cavPor3:scaffold_76:4907550:4929461:1 gene:ENSCPOG00000005182 transcript:ENSCPOT00000005237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELCRTDSTLTALDEDALWEMMESHRYKIVRSIHPSRLTPYLRQAKVLGQLDEEEVLHS
PRFTNSAMRVGHLLDLLKARGKNGAIAFLESLKFHNPDIYTLVTGLQPDVDFSNFSGLME
TSKLTACLAGAIGSLQEELAQEKAQKEMLLRQCARLQESLARAEVHIEGLRQLEADHSRM
KCEASAHFHEVLKLKDEMLSLSLHYSNTLQEKELATTRCRTLQEELYLARQELQRVDMVS
SCEWEFRERSLKMACDLEPGDKELSRLKEENQKLRSLTFSLVEKDILEQDLDEALESKQE
LVARIHSLREQAAAAERQRKQYWEEKEQTLLQFRKTQVDCELYREKMSTLQGQVAELQKE
RDQAYAARDRAQMESSQSLLEKDSLRRKVFELTDQVCELRTQLRKLQAESPAGFQPEAEA
RAPCPRGKPRLVRMHAVCPRDNSDSSLQGSTESQLWWDLSTTSSREPANSFRSASPVPPS
QQSLYKRMAEVLQEDPESLSSFPEILEVDPGIPPGTKVDLDTDLDYEILDKADLPEPEGS
LQCSSRDLSTSESSVPVRRRPARKILSQVTVLAFQGAALLEQISVIGGNLTGIFIHRVTP
GSAADEMALRPGTQIMMVNHEASTPSFKAALENTTLEQAVRLLGRVTGFCCLTVKVNTEG
YKKLVQDLEAKVATSGDSFYIRVNLALQGRAEGELQAYCNDVLHVTDTLFQNHSCWHAYR
VNPYTMKTAEHGAIPNYSQAQQRLIALIQDMTQQRTVTRKQSLGGPQKLVRIVSVDKANP
PRSSFDKSQLNPSSLEDHTSTCFWAESCFTLAPYSLVHPHKPSQPRPVIFLPRMVGKILS
RKLSLRQGFKTCPAEYLSQEEYDAWSQRGDIIQEGEPYGGHCWVTRHAVESLMHKNTHAL
LDVWLDSVCVLHRMDIFPIIVHISINEKTAKKLRKGLQRLSVSEEQLLEAARQEEMDLDK
VPCLYSSLAPDSWSDLDGLLGCVHLAILDEQKKVVWTEQRP
Download sequence
Identical sequences ENSCPOP00000004661 ENSCPOP00000004661 10141.ENSCPOP00000004661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]