SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004671 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004671
Domain Number 1 Region: 7-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-66
Family Protein kinases, catalytic subunit 0.0000759
Further Details:      
 
Domain Number 2 Region: 581-672
Classification Level Classification E-value
Superfamily DEATH domain 2.3e-24
Family DEATH domain, DD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004671   Gene: ENSCPOG00000005195   Transcript: ENSCPOT00000005250
Sequence length 674
Comment pep:known scaffold:cavPor3:scaffold_38:387222:412916:1 gene:ENSCPOG00000005195 transcript:ENSCPOT00000005250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQANMSLDDIKMNSADLLYKRNLDSGGFGAVSLCFHRMHGLVILKKVYTGPKRMEYNESL
LEEGKMMRRLSHSRVVKLLGAVIEDGNYCLVMEYMEKGNLLHVLQAQETFSTATIPLSVK
GRIIVETIEGMCYLHGEGVIHKDLKPENILVDSDFHIKIADLGVASFKTWSRLTQEEHNE
QRKASGTTRNNGGTLHYMAPEHLCDINVKPTEKSDVYSFGIMLWAIIADKEPYEYALSAE
HLLVCIKRGNRPDVDKIIEHCPTEIISLMTCCWQEDPELRPTFPGIEEQFKPFYESQFEE
FVEKDVKSLKKKYPTKNEALMRAQSLQLDCVPEPLSRSNSAAEQPGSLHSSQPLGTGPVE
ESYFSASMERQQEEYEPILQHKLQEEANYHLFGSRIDKQTKQQSTQHMAYNIEEERRRRV
SHDPFAQPRPNESAQNTRVKGPAYPSAANYSNASHQPTGLSSQPHVPCWSSESYHVHRFG
ARPLDPGIPSTVWFGSHLNQMPNPFTPPMPETSLAGSTPTLPLYSWMPPGKCLSYNLLNS
TGIQFGTSNYMEISGMNAPLENTCTNVEEESASKYQAIFDNTTSVTDIHLNPVRENLGKQ
WKTCARKLGITESQIDEIDHDYERDGLHEKVYKMLQKWEMREGNKGATVGKLARALYQCS
RKDLLNHLIDISKN
Download sequence
Identical sequences 10141.ENSCPOP00000004671 ENSCPOP00000004671 ENSCPOP00000004671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]