SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004721 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004721
Domain Number 1 Region: 64-98
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000124
Family GLA-domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004721
Domain Number - Region: 9-62
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.0693
Family VHS domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004721   Gene: ENSCPOG00000005250   Transcript: ENSCPOT00000005307
Sequence length 104
Comment pep:known scaffold:cavPor3:scaffold_28:8941903:8944822:-1 gene:ENSCPOG00000005250 transcript:ENSCPOT00000005307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLLLLTCLAALAVLTLCYESHESMESYEISKFSKQREFLKFMTPQQRWRAAVQERIRE
RNKPTYEINREACDDYKLCEQYAMLYGYNAAYNRYFRQRRGEKK
Download sequence
Identical sequences ENSCPOP00000004721 10141.ENSCPOP00000004721 ENSCPOP00000004721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]