SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004757 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000004757
Domain Number - Region: 877-933
Classification Level Classification E-value
Superfamily HCP-like 0.0256
Family HCP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004757   Gene: ENSCPOG00000005289   Transcript: ENSCPOT00000005346
Sequence length 1434
Comment pep:known scaffold:cavPor3:scaffold_72:6917864:6955701:-1 gene:ENSCPOG00000005289 transcript:ENSCPOT00000005346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFKSGLCSSRPGSDDKHTARPFPVGPRDGGGNMAAAGALERSFLELSGAERERLRQFREF
TVCGLGTSSAAPGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTCGDTVELVEESLDIN
LLNNAVRLKFQNCSILPGGVYVVETQTHVIIMILTNQTVHRLLLLHPSRMYRSELVTESQ
MQSIFTDIGKVDFRDPCSYQLIPAVPGLSPHAAASAAWLSSDGEALFALPSAAGGIFILK
LSPYDRPGTLAVVELKQSSVMQRLLTGWMPTAIRGDQGPSDRALSLAVHCVEHDAFLFAL
CQDHKLRMWSYKDQMCLMVADMLDYVPVNKDLRLMAGTGHRLRLAYSPSLGLYLGAYVHA
PQRGQFCIFQLVSTENNRYSLDHIASLFTSQETLVDFALTPTDVWALWHDAENQTIVKYI
NFEHNVAGQWNPVFLQPLPEEELVIRDDQDPREIYLRSLFTPGRFINGALCKALQIFCRG
TERNLDLSWNELKKEVTLAVESELHGSVTEYEFSQQDFRNLQHEFWSKFYACCLQYQEAL
SQPLALLLNPHTNMLCLLKKGYISFLLPTSLVDHLYLLPEENFLTEDETAISDDMEVARD
VMCLMKCLRMIGESVTTDMSVLMEMNCHNLQSPEKAAERILQDMIIIDIENVMEDVCSKL
QEMRNPAHAIGLIIREIDYETDVDMETGFNPAQPLNVRLNLSQLYGSSSAAYVVCRGVHK
IASTRFLICRDLLIFQQLLTRLGDTGLLGPGQLFQAQQEVLHRTAPLLLSYHLIKWASQC
LATDVPVDTLESNLQHLSVLELTDSGAAVACPFVSSPQTVVELFFQEVARKHIIAHLFSQ
PKAPPSQTALNWPEMITTVTNYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIHLLHPWC
QVNVGSCRFMLGRCYLITGEEHKALQCFCQAASEVGKEEFLDRLIRSEDGEVASSPRLQY
YDKVLRLLDVVGLPELVIQLATVAITEAGDDWKGQATLRTCIFKHHLDLGHNSQAYEALT
QIPDSSRQLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLTTHNYYE
LLYAFHIHRHNFRKAGTVMFEYGTRLGREVRTLRGLEKQGSCYLAAINCLRLIRPEYAWI
VQPAAGAVYDRPGTSPKRNHDGECMAAPGARQVEILELADLEKECALAHVRLVLARHDPA
AVAVAGSSSAEEMVTLLVQAGLFDTALTLCQTFKLPLTPVFEGLAFKCIRLQLGGENAQA
EAWAWLAANQLSSVVTTKESSATDEAWRLLSTYLERYKVQNNLYHQCVINKLLSHGVPLP
NWLINSYKKVDAAELLRLYLKYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAPMV
WLPYSSIDQLLQALGENTANSHNIALSQKILDKLEDYQQKVDKATRDLLFRLNL
Download sequence
Identical sequences 10141.ENSCPOP00000004757 ENSCPOP00000004757 ENSCPOP00000004757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]