SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004792 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004792
Domain Number 1 Region: 1214-1325
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-34
Family PDZ domain 0.00000453
Further Details:      
 
Domain Number 2 Region: 1622-1799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-29
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 3 Region: 497-609
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-16
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1375-1469
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-16
Family PDZ domain 0.015
Further Details:      
 
Domain Number 5 Region: 621-693
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-16
Family PDZ domain 0.028
Further Details:      
 
Domain Number 6 Region: 1478-1549
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000263
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004792   Gene: ENSCPOG00000005329   Transcript: ENSCPOT00000005386
Sequence length 1802
Comment pep:novel scaffold:cavPor3:scaffold_15:26033627:26093549:-1 gene:ENSCPOG00000005329 transcript:ENSCPOT00000005386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSTYSVLSIMPSDSESSSSLSSVGTTGKAPSPLPLPADQQVNEKVENLSIQLQLMTRERN
ELRKRLAFASHGATFDKRPYRRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAK
ETDFYHTLHSRLLSDQTQLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGD
LRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAMHNSDLSRLEQL
TEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHYELNKATAQNKDLQWEMELLQ
SELTELRTMQVRTAQESEKYREERDAVFSEYRLIMSERDQVISELDKLQTEVELAESKLK
NSTSEKKAANEEMEALRQIKDTMTVDAGRANKEVEILRKQCKALCQELKEALQETDVAKC
RRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKE
LKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAE
GVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIRALLNGEGA
INMVVRRRKSLGGKVVTPLHINLSGHKDSGISLETGVYAAAVAPGSPAAKEGTLAVGDRI
VAINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSASWSGQNIFENIKDSDKMVSLR
AHGPEVQAHNKRNLMQHNNSTQTDIFYEDRREDRKELGPPGGSSSFLHKPFLGDPFPASP
QACPSASERSLSSFRSDASVERGYGLVDMRSRQPLDKADSEGSNSGGTWPKAVPGSVTGP
EKLSVYKKPKQRKSIFDPNTFKCPQIPPKIDYVLPGPGPAHSPQPSKRVGPLTPPKPPKR
SDSIKFQHRLETSSESEATLVGSSPSTSPPTAPPPGLDPGEPMHASPPRKARVRIASSYY
PEGDGDTSCLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSGRPKLAPVVIPAQFLEEHKC
VPASGELSPETQEWSPHSPGHSSRQGTSPFYPNRPSVGTVPRNVTPSTTVSSILRNPVYT
VRSHRVGPCSSPPVPRDVGPQNLPPSVQHQGRLSLDLSHRACGDCSEMRASHGSNSLPSS
ARLGSSSNLQFKAERIKIPLTPRYPRSVMGSDRGSLSHSECSTPPQSPLNIDTLPACSQP
QTSASTLPRIAVNPTSHGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVT
PGSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILTQYNPHMHQLSSHS
RSSSHLDPAGAHSANQGSGATTPEHPSVIDPLMEQDEGPGTPPAKQSTPSSRTVGDANKK
PPEPRVVFIKKSQELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLMPGDLILEYGNLDVRN
KTVEEVYVEMLKPRDISRLKVQHRPEDFARIKGLPGDGFYIRALYDRQGEVEHDLSFKKD
DILYVDNTLPQGAFGCWMAWQLDESAHKMQRGQIPSKYVMDQEFSRRLSMSEVKDDSGAA
KTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDTFSNDSIPLFEDSVSLAYQRVQKVDCT
SLRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDFKRRSGH
FDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKQIKEQRDPVYL
RDKVTQRHSKEQFETAQKIEQEYSKYFTAVVQGGPLSSICTQILAIVNQEQSKALWIPAS
SI
Download sequence
Identical sequences ENSCPOP00000004792 ENSCPOP00000004792 10141.ENSCPOP00000004792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]