SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004797 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004797
Domain Number 1 Region: 689-835
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1016-1114
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-30
Family Ras-binding domain, RBD 0.0008
Further Details:      
 
Domain Number 3 Region: 218-369
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-22
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 4 Region: 12-97
Classification Level Classification E-value
Superfamily PDZ domain-like 9.85e-20
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 961-1030
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000558
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004797   Gene: ENSCPOG00000005334   Transcript: ENSCPOT00000005391
Sequence length 1336
Comment pep:known scaffold:cavPor3:scaffold_166:1436905:1492561:-1 gene:ENSCPOG00000005334 transcript:ENSCPOT00000005391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRAGEPVKRPPLGPVPPRLRSVEVARGRAGYGFTLAGQAPCVLSGVIRGSPADFVGLRA
GDQIFTINEINVKKASHEDVVKLIGKCSGVLRLVIGEGAGHPEACSSDDEGGLCEGKGWL
RPKLDSKALGINRAERVVEEMQSGGIFSMIFENPSLCMSTPEPSQGKQRSLSESASVRLE
GSPNAVQTGLLSKEELVRVIHDDSVFSAGPENLDSFALDASILNVAMVVGYLGSIELPST
SCNLESDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDRVLLCSDKACVVAEYPAEKLAFSA
VCPDDRRFFGLVTMQTNDDGSLAQGEEGALRTSCHVFMVDPDLFHHKIHQGIARRFGFMC
TADPDTSGCLEFPASSLPVLQFISILYRDMGEFIEGVRARAFLDGDADAHQNNSTSSNSD
SGIGNFNQEEKSNRVLVVDLGGGLSRHGPGSSASWEGAGARSSQSWAASWSRSFCHSPEG
CASFEAGPQADRLRDLSKHLGPASHTEGTPASLWSSVPPSKRGSASTSCGLSQRWLPVHV
LQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFMQAPLSAQKRDW
ARKAFGMQNLFGPSRNVRRTKEDKKGSKFGRGIGLAQTSQRSSARRSFRRSKRFSITRSL
DDLESATVSDGELTGADLKDCVSSNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQD
PVGIRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSHRAREIFSKFLCSKATTPV
NIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRALP
DAQQVPSSPASKHSIGSDHSSTSTPKKLSGKSKSGRSLNEDAGDEDSEKKRKGAFFSWSR
SRSTGRSQKKKEPGDHGQDTLPTNGGLCRRRESQGSVSSAGSLDLPEACRTLVPEKDKAV
KHCCIYLPDGATCVVAVKSGFSIKEILAGLCERHGINGAAVDLFLVGGDKPLVLHQDSSI
LASRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGE
KEPLDLGAPISSLDGQRVVLEERDPARGRAPTDKQKGALAKPSAAASSRPRDRSATGEER
TLGKSNSIKIKGENGKNARDPRLSKREESIAKYQKINLDEAEEFFELISKAQSNRADDQR
GLLTKEDLVLPEFLRLPPGSTKLPLCTLAAGKGFSKRPETTGHSREKASLPSDSPATGPR
GASPLGQKVQEGPTQVWRRRQSQEVEDGGIQTEDESRADLTLVGEGDISSPNSTLLPPPP
SPQDAPGPLRPGTSQF
Download sequence
Identical sequences ENSCPOP00000004797 ENSCPOP00000004797 10141.ENSCPOP00000004797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]