SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004823 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004823
Domain Number 1 Region: 968-1095,1129-1334
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-69
Family p120GAP domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 37-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-38
Family Calponin-homology domain, CH-domain 0.0000258
Further Details:      
 
Domain Number 3 Region: 1560-1657
Classification Level Classification E-value
Superfamily RGC domain-like 2.48e-29
Family RGC domain 0.000012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004823
Domain Number - Region: 683-712
Classification Level Classification E-value
Superfamily WW domain 0.000426
Family WW domain 0.0024
Further Details:      
 
Domain Number - Region: 737-801
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00101
Family Motor proteins 0.018
Further Details:      
 
Domain Number - Region: 795-860
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0398
Family Motor proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004823   Gene: ENSCPOG00000005361   Transcript: ENSCPOT00000005418
Sequence length 1657
Comment pep:known scaffold:cavPor3:scaffold_10:17076011:17109895:-1 gene:ENSCPOG00000005361 transcript:ENSCPOT00000005418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSEDPMDFLQLASAFKSVLENDNERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLK
EELPSPVELEESLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFW
LSAIAHIGLPSTFFPETTDIYDKKNMPRVIYCIHALSLFLFRLGLAPQIHDLYGKVKFTA
EELSNMASELAKYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTFTA
LQNPSALLGNLREPLAAIYQELLAQAKMEKAANVRNHFLQDDRESQDIYDYYLTQDEIQD
NINHVNVLGALEVVDDALERQSSEALLEALQDPALTLRGLRRDFADWYLAQLSSDREQKA
QELGLGELLLKEEVQAAVAAANVKGDQQQAMLQAVQRINRAIQRGAAADTMKELMNPAAQ
LPPVYPFASAVYQQELTVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASSFWSSL
MSPATGLAEVEGENAQRYFDSLVELQQVRGADEAFLSWNDLQATVNRVNTQVQEETDQVL
AVSLINEALDQGSLEKTFSALLLPAAGLKDVTLSVAPRYYFLLVEAKRHKAQVTGDPGAV
LWLEEIRQAVVRANQDTQTAQRMALGVAAVNQAIKEGKAAQTERVLRNPAVALRGVVPDY
ASSYQQALESAAAKKQHPGDTGLWVQHNMKDGTAYYLHLQTFQGTWEQPPGCCLNTSHLN
RDEIQSTITKVSAAHDRQQLWKAHMSFIIRLQACLRGFLVRRKFAEESHFLRTRLPAVIK
IQAHWRGYRQRKIYLERLQYFKANLDAIIKIQAWTRMWAARRRYLRRLHYFQRNVDSVVK
IQAFFRARKVRDDYRILVHTAHPPLSVVRRFIYLLNQSQQDFSAEAELLKLQEEVVRKIR
SNQQLEQDLNLMDIKIGLLVKNQITLQEVVSHCKKLTKKNKEQLSDMMVLDKQKGLKSLS
KEKRQKLEAYQHLFYLLQTQPIYLAKLIFQMPQNKTTKFMESVIFSLYNYASNLREAYLL
LQLFKTALQEEIESKVEHPQDVVTGNPTVVRLVVRFYRNERGQSALREILGKVIQDVLED
KVLSIHTDPVHLYKSWINQTEAQTGQRSHSHLPYDVTPEQALSHPEVQRRLDISLRNLLA
VTEKFLVAITSSVDQIPYGMRYVAKVLKTTLAEKFPDATESEVYKVVGNLLYYRFLNPAV
VAPDAFDIVAMAAGSTLAAPQRHTLGAVAQLLQHAAAGKTFSRESRHLQVLNNYLEETHL
KGRKFIYRACQVPEPEERFAMDEYSDMVAVAKPVVYITVGELINTHRLLLEHQNWIAPNP
QDHLHQLLKDLGKLPTISDLIGESIATDEHLDPSKLEVSLTLINKFEGLEADADDTNTQS
LLLSTKQMLADLIQFHPGDTLEEILSLSAPREQEAAHKLLMCQRQAREAQTPEPLRRHRS
LTARSLLPLAEKQRRVLRNLRQLESLGLVSANNGYQVLVDELAKDIRNQRRHRQRRKAEL
VKLQATFQGLCTKTTFYEEQGDYYSQYIQSCLNHLAPSSNSLPKSGAQAQNSGKGKKQPS
LHYTAAQLLEKGVLLEIEDLPASHFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQLYYQ
DLLQLQYEGIAVMKLFNKARVNVNLLIFLLNKKFLRK
Download sequence
Identical sequences ENSCPOP00000004823 ENSCPOP00000004823 10141.ENSCPOP00000004823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]