SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004883 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004883
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.77e-35
Family Calponin-homology domain, CH-domain 0.0000497
Further Details:      
 
Domain Number 2 Region: 180-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000156
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004883
Domain Number - Region: 209-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000121
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004883   Gene: ENSCPOG00000005426   Transcript: ENSCPOT00000005484
Sequence length 976
Comment pep:novel scaffold:cavPor3:scaffold_30:12167865:12186357:1 gene:ENSCPOG00000005426 transcript:ENSCPOT00000005484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIKALQQWCRQQCEGYRDVDITNMTTSFRDGLAFCAILHRHRPDLINYSALRKENIYE
NNKLAFSVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGIKR
PPSDPEEEPSGKKAPSTPAKLPSSAPAQALPAPAARTSSMAQRMDGGPKAAQTVAGSAVS
STCAVCGKHVHLVQRHLVDGRLYHRSCFKCKQCSSTLRSGAYRATGEPGIYVCTSHHSRA
TSANTALPALTSKQPAATPVDAGAPSVLQKTQEMNGLREAAPKAQPVAHRPVVGNTTAKG
FARITSEPPASTVPIQVGSPAGPRLPANPVASLLEHSTASTHVTGRSPMGRTSHAQYPAT
NSSRSAPSIPEPCPATPQGLGPPRVSTSVTKLGLNSASPGAADPPAWTPSATRTQQARER
FFQSPAAPTSGPVGQTPAPANAPFRDSSREQALSFLKKALSGVEAAGAQAPGKVPPWGSP
ASTPYAAALSSLEPSKACPGQSRALNKALRGGVPVLLDLASRTYEVPEVGAHHPWGAPSS
CWGVRPGSWLQVRLWGSCLEGAHGPSHAWYLLLTHRSSPAMNSCPKTEGPKAVPSGKPLQ
SDAPHTLSSTSRTEPSARLSVGSTSQVGKSPATSSGVIKEGTGSRLKPEAPTAKGPSTSP
QQSQEDGPEGWRARLKPVEKKPPAGRAQEPKEPRVPAEPKAGEAPVAPRTPVQVSGHVQV
GVQITLTPVQPEQTLAHAGPGTKLPEASPSSSSRRRLAIPPSLDISANWLQSEPSEQEAQ
VQSWKEKPHSQDKPGRPSALAGIPASPEKTVSSPIRLHPDYVPQDALELRGVALEQQLRA
ADGAAEEDDLMVAWFRLVHEKQLLLRQESELMYKSKTQRLEERQQDLEGELRRLMAKPEY
LKTPQDQRREQELLSQYVSTVNDRSDIVDILDEDRLREKEEDQVLQDMIQRLDLQKKKPK
FRLSKIWGTKNKGAPQ
Download sequence
Identical sequences 10141.ENSCPOP00000004883 ENSCPOP00000004883 ENSCPOP00000004883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]