SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004887 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004887
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-48
Family Ankyrin repeat 0.0000882
Further Details:      
 
Domain Number 2 Region: 310-374
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000903
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004887   Gene: ENSCPOG00000005430   Transcript: ENSCPOT00000005488
Sequence length 375
Comment pep:novel scaffold:cavPor3:scaffold_212:82381:115470:-1 gene:ENSCPOG00000005430 transcript:ENSCPOT00000005488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVIHLAAWSGSFEILLMLVKAGADQRATGRDGLNALHFAAPSNSVHIAEYLIGDLHLRE
LGQRGQARAHSIGRLPFFDIGVVAHACRFNNPDDKNGRKPFLLAAGRGHLEMIEKLTQLN
LHTLEKGKEGNTALHLAAMHGHSPAVQVLLTQWPEVNESNEEIFSCGHRIEAVAGGHEER
SKVLLEAGSDINIPNKPSESPLHVAVSKNHVTVVSSLLQARHDTDILNERQQTPLHVAAD
LGNVELVDTLLKAGCDLKAVDKQGRTALAVAARGSHCLVVDMLINGTRPEIQWQEAPRNG
KSCSLWRQDHSLETRHLRTFLWDLAYCQLKATEWQRLAHSWDFTDDQIRAIEEQWTGKNS
FHEHGHRALLIWLHG
Download sequence
Identical sequences ENSCPOP00000004887 10141.ENSCPOP00000004887 ENSCPOP00000004887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]