SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005428 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005428
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-22
Family Kringle modules 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005428   Gene: ENSCPOG00000006014   Transcript: ENSCPOT00000006078
Sequence length 268
Comment pep:known scaffold:cavPor3:scaffold_4:11853442:11863625:1 gene:ENSCPOG00000006014 transcript:ENSCPOT00000006078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGWAQTFLLSSMLLAEAFGSGGCFWDNGHLYREDQSSPAPGLRCLNWLDARGGLEPAL
VLGAGNHNYCRNPDRDPRGPWCYVSGEAGTPEKVPCQDARCPETTSQAPPTSTSQSEETT
EVPGGNEALVFAPANTLPARSEAAAVQPVIGIGQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHEQKVCKREMHQSTLPMSSYTNPAYANTSFETVDERT
VVVHSNQPPVDLQEGSMPLMGQAGTPGA
Download sequence
Identical sequences ENSCPOP00000005428 10141.ENSCPOP00000005428 ENSCPOP00000005428 XP_003478347.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]