SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005469 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005469
Domain Number 1 Region: 199-276
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.35e-18
Family Middle domain of MutM-like DNA repair proteins 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005469
Domain Number - Region: 284-324
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.057
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005469   Gene: ENSCPOG00000006058   Transcript: ENSCPOT00000006122
Sequence length 336
Comment pep:known scaffold:cavPor3:scaffold_1:65026035:65030981:-1 gene:ENSCPOG00000006058 transcript:ENSCPOT00000006122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPSVRKFHHLVSTFVGQQVLKTGGSSKKLCPATLQSLWLQDTQVHGKKLFLRFDADA
EGEGEGGAPGGSHQHLEPLRKTARKEAAGDPAPEASGQKTAADGSFQSMELLPRGPGDSS
DLAGDSPLPGAQQWLQVSFGLFGSIWANEFSRAKKANKRGDWRDPVPRLVLYFDGGGFLA
FYNCQMSWSPTPVVEPHRDILSEEFHRGQALEALGQPQPVCYTLLDQRYFSGLGNIIKNE
ALYRARIHPLSLGSLLTSPCLETLVDHVVAFSAEWLQGKFQGQPRHTQVYQKEQCPSGHQ
VLREVLGPPGGLQRLTWWCPQCQPRVPPEETPQHQS
Download sequence
Identical sequences H0V6X8
XP_003479739.1.53824 XP_012998666.1.53824 ENSCPOP00000005469 10141.ENSCPOP00000005469 ENSCPOP00000005469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]