SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005776 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005776
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.75e-46
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005776   Gene: ENSCPOG00000006410   Transcript: ENSCPOT00000006475
Sequence length 225
Comment pep:known scaffold:cavPor3:scaffold_71:5110750:5111424:-1 gene:ENSCPOG00000006410 transcript:ENSCPOT00000006475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLSLTDLALSSTTVPKMLSILWLHTGEISFNGCLAQMFCVHSIYALESSVLLAMAFDRF
VAICNPLRYTTILNRTVIGQIVFVGIFRSVAIVSPFIFLLRRLPYCGHHVMAHTYCEHMG
IARLACANITVNVIYGLTVALLAMGLDSILIAISYGFILHAVFHLPSHDAQHKALSTCGS
HLGVILVFYIPAFFSFLAHRFGHNRVPKHVHIFLANLYVLVPPVL
Download sequence
Identical sequences ENSCPOP00000005776 10141.ENSCPOP00000005776 ENSCPOP00000005776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]