SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005780 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005780
Domain Number 1 Region: 15-306
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-62
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 435-517
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-17
Family Caspase recruitment domain, CARD 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005780   Gene: ENSCPOG00000006415   Transcript: ENSCPOT00000006480
Sequence length 538
Comment pep:known scaffold:cavPor3:scaffold_0:25208658:25234283:-1 gene:ENSCPOG00000006415 transcript:ENSCPOT00000006480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSPSCSGLPTVPSHKLADLRYLSRGASGTVSAARHADWRVQVAVKHLHIHTPLLDSERD
DVLREAEILHKARFSYILPILGICIEPEFLGIVTEYMPNGSLNELLHRKTEYPNVAWPLR
FRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRGS
KSSPEGGTIIYMPPENYEPGQKTRASVKHDIYSYAIITWEVLSRKQPFEEVTNPLQIMYS
VSQGRRPDTNEESLPLDIPHRALMISLIERGWAQNPDERPSFLKCLIELEPILRTFEEIT
FLEAVIQLKKTKLQSTLSTIDLCDKKKMESPLDIPVNHSPTEESCGPSQLHKSTSSSGTS
RLQSVPQNIDFLTVKPQDCSSVKLDHCLVKRSWDNTVSAFQRATLYDHRTACSLAVINTP
TDERNPEHLQPGIAQQWIQSKREDIVSQMTEACLNQSLDALLSRDLLMKEDYELISTKPT
RTSKVRQLLDTTDIQGEEFAKIIVQKLKDNKQMGLHPYPEILMTSRSLSLNFTQNKSF
Download sequence
Identical sequences 10141.ENSCPOP00000005780 ENSCPOP00000005780 XP_003479939.3.53824 ENSCPOP00000005780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]