SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005822 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005822
Domain Number 1 Region: 295-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-42
Family Regulator of G-protein signaling, RGS 0.0000232
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-30
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 222-284
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.7e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005822   Gene: ENSCPOG00000006465   Transcript: ENSCPOT00000006530
Sequence length 461
Comment pep:known scaffold:cavPor3:scaffold_12:12964951:13194214:-1 gene:ENSCPOG00000006465 transcript:ENSCPOT00000006530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMA
AHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELA
DYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGC
VNTTEVDIKKSSRMRNPHKTRKSVYGLQNDVRSHSPTHTPTPETKPPTEDELHQQIKYWQ
IQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEASKEPSQQR
VKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRVQEIWQ
EFLAPGAPSAINLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQE
LLQAKKKSGNSMDRRTSFEKIAQNMGKTLTSKRLTSLVQSY
Download sequence
Identical sequences 10141.ENSCPOP00000005822 ENSCPOP00000005822 ENSCPOP00000005822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]