SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Cavia porcellus 69_3 > ENSCPOP00000005868

Domain assignment for ENSCPOP00000005868 from Cavia porcellus 69_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCPOP00000005868
Domain Number 1	Region: 30-66
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000128
Family	LDL receptor-like module	0.0011
Further Details:

Domain Number 2	Region: 111-148
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000367
Family	LDL receptor-like module	0.0012
Further Details:

Domain Number 3	Region: 71-108
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000458
Family	LDL receptor-like module	0.0015
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCPOP00000005868 Gene: ENSCPOG00000006516 Transcript: ENSCPOT00000006581
Sequence length	344
Comment	pep:known scaffold:cavPor3:scaffold_92:2786326:3037702:-1 gene:ENSCPOG00000006516 transcript:ENSCPOT00000006581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MWLLGPLCLLLSSPAAESQLLPGNNFTNECNIPGNFMCGNGRCIPGSWQCDGLPDCFDKS DEKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYH CRNGLCIDKSFLCDGQNNCQDNSDEEGCESSQEPGSGQVFVTSENQLVYYPSITYAIIGS SIIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGI QYVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGS VDSASSRAASSLLSVEDTSTSPGQPDPLEGTAPPRDSVPSPGTE
Download sequence
Identical sequences	10141.ENSCPOP00000005868 ENSCPOP00000005868 ENSCPOP00000005868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]