SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006118 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006118
Domain Number 1 Region: 232-333
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 3.4e-38
Family HIN-200/IF120x domain 0.00032
Further Details:      
 
Domain Number 2 Region: 334-421
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 2.56e-32
Family HIN-200/IF120x domain 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006118
Domain Number - Region: 5-81
Classification Level Classification E-value
Superfamily DEATH domain 0.000918
Family DEATH effector domain, DED 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006118   Gene: ENSCPOG00000006788   Transcript: ENSCPOT00000006857
Sequence length 425
Comment pep:novel scaffold:cavPor3:scaffold_56:8361165:8374944:1 gene:ENSCPOG00000006788 transcript:ENSCPOT00000006857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTFKEIVLLQGLHPISDYHFRMIKSLLASELKLKGSKYEEYDKIKFADMMAEKFPSDA
GLRKLISFFSKIPELEDTAELLKKQKAKDKKKCTVKDKTTRKRSKQDKLSAGRSTLTTDE
DYKRESVLDVPLSKQLVSLSFPRQPTPSNSQQSPQMLPTTVFTTGNSPHTSSRAVQTSQL
HPKTPSCSLQTHETIVTTPSGVQILLLPSTSICKDRCSKKPSPKYEPDEENGYQSGPKEV
MVLKVTEPFTYVVTQSEHRMIHATVATENAFFRVKVFDMKFKDKFIPKNIIAISNYVGRN
GFLEINKFSSVSNVSADRKMNIIPALIQQAKATPKISQLGSQSKGKYVNGIFLVCKKQVR
PECIYYEIQDNTGKMEVFVHGRLTHIHCEEGDKLNLTCFEVASSWNGWQLRSVLHSHLKV
IKARK
Download sequence
Identical sequences 10141.ENSCPOP00000019872 ENSCPOP00000006118 ENSCPOP00000019872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]