SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006189 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006189
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-42
Family Calponin-homology domain, CH-domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006189   Gene: ENSCPOG00000006865   Transcript: ENSCPOT00000006934
Sequence length 311
Comment pep:known scaffold:cavPor3:scaffold_2:20608746:20614638:-1 gene:ENSCPOG00000006865 transcript:ENSCPOT00000006934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIASKYDHQAEEDLRNWIEEVTGMSIGTNFQLGLKDGIILCELINKLQPGSVKKVNESSL
NWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTI
DIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKP
FDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGM
SVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPR
DYQYGDQGIDY
Download sequence
Identical sequences ENSCPOP00000006189 10141.ENSCPOP00000006189 ENSCPOP00000006189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]