SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006233 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006233
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000461
Family Calmodulin-like 0.069
Further Details:      
 
Domain Number 3 Region: 227-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000293
Family VWC domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006233   Gene: ENSCPOG00000006912   Transcript: ENSCPOT00000006981
Sequence length 307
Comment pep:known scaffold:cavPor3:scaffold_35:21769805:21785162:-1 gene:ENSCPOG00000006912 transcript:ENSCPOT00000006981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWEKKVAANQLSWALVFSSQEEIRSKSKVCANVFCGAGRECAVTEKGEPTCLCIEQCKPH
KRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQANRDEL
RRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKHFDNGDSRLDSSEFLKFVEQNETAINI
TTYADQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYA
DGAETEVDCNRCVCACGNWVCTALTCDGKNQKGAQTQTEEEMTRYVQELQKHQDTAVKTK
RVSAKEV
Download sequence
Identical sequences 10141.ENSCPOP00000006233 ENSCPOP00000006233 ENSCPOP00000006233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]