SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006423 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006423
Domain Number 1 Region: 42-329
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.33e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000604
Further Details:      
 
Domain Number 2 Region: 343-455
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.28e-27
Family Anticodon-binding domain of Class II aaRS 0.00000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006423   Gene: ENSCPOG00000007124   Transcript: ENSCPOT00000007195
Sequence length 459
Comment pep:known scaffold:cavPor3:scaffold_65:5495651:5516793:-1 gene:ENSCPOG00000007124 transcript:ENSCPOT00000007195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSGAAVRACHKVCRRLLSGFEGRVDGESEQIEIPESAEGGEALLEVCQRRHFLNGTKHV
SRDSLLRGCHHGFGPLGVELRKNLAAEWWSSVVVCREQVFPVDALHHDPRPSLLGDGAFR
LVSAEALREILQDKELSKERLVAFLRLLKTPGNYRKTLSSGRALEHYVSGLDLVNKKLPY
GLAQIGVCFHPVPGTNELPSGVKRIGEKTEASLVWFTSSRTSSQWLDFWLHHRLLWWRKF
AMSPSNFSSSDCQDEEGRKGNRLYYSFPWGKEPIEVIWNLGDKELLHMHPGDVSKLHGRD
GRRPVVPSVISVSGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALD
VGRGPTVELRQVCQGLFNELLENGISVWPGYLETVQSSLEQLYSKYDEMSILFTILITET
TLENGLIQLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Download sequence
Identical sequences ENSCPOP00000006423 10141.ENSCPOP00000006423 ENSCPOP00000006423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]