SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006451 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006451
Domain Number 1 Region: 358-535,699-834
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-39
Family Tandem AAA-ATPase domain 0.0017
Further Details:      
 
Domain Number 2 Region: 118-201
Classification Level Classification E-value
Superfamily DEATH domain 0.00000212
Family Caspase recruitment domain, CARD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006451   Gene: ENSCPOG00000007154   Transcript: ENSCPOT00000007225
Sequence length 1024
Comment pep:known scaffold:cavPor3:scaffold_3:26451245:26504412:1 gene:ENSCPOG00000007154 transcript:ENSCPOT00000007225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMSNAYSTDKCFRYLLSCFRTRVKMYIQVEPVLDYLTFLPRDVKEQIMRTANTSGNMKAV
ELLLNTLEQEQGWAPGWTREFVDALQRAGSALAARYVNPDLTDLPSPSFETTQDECLQLL
TLLQPTLVDKLLVRDVLDKCTEVDLLTIEDRNRISAAENNGNESGVRELLQRIVQKENWF
STFLNILHQTGNSALARDLTGVDHSESNAEIENLLYEEGPDINESLCSAKEQPNLEKKEW
HAENNLSEASCADSSAVSESDTSLAEGSVSCLDESLGHNKFCNSDHPTLSEAIDEENVAK
RASPEPELKLRSYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKGQASEPGK
VIVLVNKVMLVEQLFTKEFKPFLKKWYRVTGLSGDTQLKISFPEVVKSHDVIISTAQILE
NSLLNSESGEDAGVQLSDFSLIIIDECHHTNKEDVYNNIMRRYLKQKLKNKALQKENKSV
VPLPQILGLTASPGVGGATKQAKAEEHILKICANLDASTIKTVKDYYNQLKDQIKEPCKK
FVIADDTREDPFKDKLLEIMSSIQAYCQVSSMSDFGTQNYEQWTIQMSSLASREGDRKIR
VCAEHLRKYNEALQINDTIRMIDAYNHLETFYHDEAAKKFAVQEDDSDDDGCDGDKDKDN
TKRLVKEDKTDRFLMTLFFGKIKVVILSLADNPEHENEKLSKLRNTILEQFTRTEKPTRG
IIFTKTRQSAYALSQWIAENEKFADVGIKAHHLIGAGHSSEFKHMTQNEQKEVISKFRTG
KINLLIATTVAEEGLDIKECNIIIRYSLVTNEIAMVQARGRARAEESTYVLVAHSGSGVV
ERETVNDFREKMMYKAIHHVQNMNPEEYAQKILVFQMQNIMENKMKTKRNNVKHFKNNPS
SITFLCKNCQILACSGEDIHVIERMHHVNMTKEFKRLYVTRENKALQSKFADYQTNGEII
CKCGQAWGIMMVHKGLDFPCLKIKNFVVVFKDNSQKKQYKKWVELPITFPELDYSEYCTF
SDED
Download sequence
Identical sequences 10141.ENSCPOP00000006451 ENSCPOP00000006451 ENSCPOP00000006451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]