SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006586 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006586
Domain Number 1 Region: 1011-1115
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-31
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006586
Domain Number - Region: 683-746
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0948
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006586   Gene: ENSCPOG00000007308   Transcript: ENSCPOT00000007380
Sequence length 1117
Comment pep:known scaffold:cavPor3:scaffold_4:8814830:8932047:-1 gene:ENSCPOG00000007308 transcript:ENSCPOT00000007380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKASRSVGSVPKVSGTSKTQTEKIKPENSSSASTGGKLVKPGTAALLSKTKSSDDLLAG
MAGGVTVTNGVKGKKSICPSAASSASAPAMTTVENKPKINTGTSSSTKRSTSAGNKESSS
TRERLRERTRINQSKKLPSAGQGANDVALAKRSRSRTAMECDVRMSKSKSDNQISDKAAL
EAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEEKETIIVHQPTDVE
STLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITP
GNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSLDNLDSECSEVYQPLTSSD
DALDAPSSSESEGLPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQE
LADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVID
EDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
SHHMERIIESEQKGKAALAATLEEYKATVSSDQIEMNRLKAQLENEKQKVAELYSIHNSG
DKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAKK
QIEDLNLTLEKLRSELEEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHE
AQEKNEKLTKEVEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPT
VKTLIKSFDSASQVPNPAAATIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTT
LSDKRPNYGEIPVQEHLLRTSSTSRPASLPRVPAMESAKSISVTRRSSEEMKRDISAPEG
ASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNALLKW
CQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKKRNFTLAFQAAE
SVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences H0V9T1
10141.ENSCPOP00000006586 ENSCPOP00000006586 XP_003478010.2.53824 XP_012997399.1.53824 XP_012997400.1.53824 XP_012997401.1.53824 XP_012997402.1.53824 ENSCPOP00000006586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]