SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006587 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006587
Domain Number 1 Region: 297-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-41
Family Regulator of G-protein signaling, RGS 0.0000265
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-26
Family DEP domain 0.016
Further Details:      
 
Domain Number 3 Region: 222-286
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 6.28e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006587   Gene: ENSCPOG00000007309   Transcript: ENSCPOT00000007381
Sequence length 445
Comment pep:known scaffold:cavPor3:scaffold_20:16650943:16841737:1 gene:ENSCPOG00000007309 transcript:ENSCPOT00000007381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIEDIITKMQDDKTGGVAIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSL
IAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLE
LADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVP
GCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQSQSPVHIPSQPIRKTTKEDIRKQITF
LNAQIDRHCLKMSKVAESLIAYTEQYVEYDPFITPAEPSNPWISDDITLWDIEMSKEPSQ
QRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEI
WQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY
QDLLLAKKKGKSLAGKRLTGLMQSS
Download sequence
Identical sequences ENSCPOP00000006587 10141.ENSCPOP00000006587 ENSCPOP00000006587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]