SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006607 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006607
Domain Number 1 Region: 30-303,362-456
Classification Level Classification E-value
Superfamily Sialidases 5.33e-100
Family Sialidases (neuraminidases) 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006607   Gene: ENSCPOG00000007330   Transcript: ENSCPOT00000007402
Sequence length 478
Comment pep:known scaffold:cavPor3:scaffold_13:22516645:22519107:-1 gene:ENSCPOG00000007330 transcript:ENSCPOT00000007402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAQGGTERGSGLNCRDPCPYSMGASSAPARTVLFRRERTGLTYRVPALLPVPPGPTLLAF
AEQRRSPDDAHAHRLVLRRGAVAAGAVQWGALRVLATAALEEHRSMNPCPVLDAGSGTVF
LFFIAVLGETPEAVQIATGRNAARLCCVTSRDAGLTWEGTRDLTEETVGTLIHDWATFAV
GPGHGVQLHSGRLLVPAYTYRVDRRECFGKVCWTSPHSFTIYSDDQGRTWHCGGLVPNLR
SGECQLAAVDGGFLYCNARSPLGSRVQALSPDEGTSFLPAELVPTLSETARGCQGSIIGF
PAPVPSREEGPNPPYLCPGVQESLSGPFCHLQHWRDSQEQPGPEPGLGGDEGTYAPLLSL
PSMASLQKSTWLLYSHPAGHRARIRMGIYLSRSPLDPQSWTEPWVIYEGPSGYSDLATLG
SVPGPTLAFACLFESGSRVSYEDISFCMFSLGEVLENVSGDPELLHHRSKPWKHCRPS
Download sequence
Identical sequences ENSCPOP00000006607 ENSCPOP00000006607 10141.ENSCPOP00000006607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]