SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006664 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006664
Domain Number 1 Region: 401-804
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-134
Family Ankyrin repeat 0.00000000000057
Further Details:      
 
Domain Number 2 Region: 45-419
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.03e-114
Family Ankyrin repeat 0.000000164
Further Details:      
 
Domain Number 3 Region: 1400-1481
Classification Level Classification E-value
Superfamily DEATH domain 4.37e-21
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006664   Gene: ENSCPOG00000007390   Transcript: ENSCPOT00000007462
Sequence length 1869
Comment pep:known scaffold:cavPor3:scaffold_80:1225338:1295331:1 gene:ENSCPOG00000007390 transcript:ENSCPOT00000007462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFLQADAATSFLKAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVEL
LHKEIILETTTKKGNTALHIAALAGQNEVVRELVNYGANVNAQSQKGFTPLYMAAQENHL
EVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARND
DTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGASVNFTPQNGITPLH
IASRRGNVIMVRLLLDRGAHIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKN
GLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP
NSRALNGFTPLHIACKKNHVRVMELLLKTGASIEAVTESGLTPLHVASFMGHLAIVKTLL
QRGASPNASNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTH
MVKLLLENSANPNLATTAGHTPLHIAAREGHVDTALALLEKEASQACMTKKGFTPLHVAA
KYGKVRVAELLLERQAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPQGSSPHSPAWNGYT
PLHIAAKQNQMDVAHSLLQYGGSANAESVQGVTPLHLAAQEGHADMVALLLSKQANGNLG
NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ
ANVNAKTKLGYSPLHQAAQQGHTDIVTLLLRSGASPNEVSSNGTTPLAIAKRLGYISVTD
VLKVVTDETSIVLVGDKHRMSYPETVDEVLDVSEDEGEEFVGSKAEQLDSRDVDEERELL
DFVPKLDQVVESPAIPRIPCVTPETVLIRSEEPEQASKEYDEDSLIPSSPATETSDNISP
VASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLGTPPP
LAEEEGLASRIIALGPAGAQFLSPVIVEIPHFASQGRGDRELVVLRSENGSVWKEHRSRY
GESSLDQILSGLDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDFDTIGPEGGSLK
SRLVPLVQATFPENAVTKKVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRKFHRP
IGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANECANFT
TNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDD
KVDKTLEQHENFVEVARSRDIEVLEGMPLFAELSGNLVPVRRAAQQRSFEFQSFRENRLA
IPVKVRDSSREPAGFLSFLRKAMKYEDTQHILCHLNVTMPPCTKGTGAEDRRRTLTPLAL
RYSVLSESALGFPSGMDRADLKVAVITEHLGLSWAELARELQFSVEEINRIRVENPNSLW
EQSAALLNLWAAREGADAKMESLYAALRNIDRSEIVNMLEGSSRQSRNLRPEQRQADRDY
SLSPSQMNGYSSLQDELLSPASLHYALPSPLRADQYWNEVAVIDAIPLAPTEHDAMLEMS
DMQVWSAGLTPSLVTAEDSSLECSKAEDSDATQEWKLEGALSEESRGPELGSQDLVEDDT
VDSDATNGHAGLLGQEEGQRSKEERQEGSAGAGQDAENEVSLVTGQRRAPGRAADLSSMS
RVQDRSQDRLQDWDLEGSIASYLQDAEQGPYPFRTTPSTVQGPEHGDVLVPTSEHTGTAQ
PETQGPRAGREDEVQVAVSTLQQKFQGNELQNIPGEQVTQEQYTDEQGNLVTKKITLKVV
RQLDDTQEHEEVIVGGPLEKDTSVLETDPDFITKLDKVELRGSGLQPELLEGRKGAQIVK
RASLKRGKQ
Download sequence
Identical sequences ENSCPOP00000006664 ENSCPOP00000006664 10141.ENSCPOP00000006664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]