SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006692 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006692
Domain Number 1 Region: 7-257
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000033
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006692   Gene: ENSCPOG00000007419   Transcript: ENSCPOT00000007491
Sequence length 295
Comment pep:known scaffold:cavPor3:scaffold_11:44143857:44144741:-1 gene:ENSCPOG00000007419 transcript:ENSCPOT00000007491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRRLGIFFIIIYVFESLTVMAQSSFTVAVLGRKWVQVKRLSPVEMTLTSLSICRFFLQ
WTSMLNNFCFYFHPDCVLWHTGTIWEFTNILTFWLTSLLAVLYCVKISCIAHPIFLWLRW
RISRLVPWLLLGALVISCAAVIPRAIRNHIFLQLAPLTHVPTNNSLIERLNMLEPYVSGA
QKMFLLTIPFLLFLICTVFLMASLIQHRKKMQKYNTGHSGSSQKAHSTALKSLAVFFVIF
LTYFLSVIITYTGIVSKRGWWYWAWEAGMYALISVHSTSLMMSSPTLKKAIKVKC
Download sequence
Identical sequences ENSCPOP00000006692 ENSCPOP00000006692 10141.ENSCPOP00000006692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]