SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006701 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006701
Domain Number 1 Region: 69-113
Classification Level Classification E-value
Superfamily TNF receptor-like 2.98e-18
Family BAFF receptor-like 0.00033
Further Details:      
 
Domain Number 2 Region: 37-72
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000636
Family BAFF receptor-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006701   Gene: ENSCPOG00000007429   Transcript: ENSCPOT00000007501
Sequence length 289
Comment pep:known scaffold:cavPor3:scaffold_65:721337:733020:-1 gene:ENSCPOG00000007429 transcript:ENSCPOT00000007501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGCGQENRLGARRLASCPHSLHLSAPQGLWPGVAMGLCPEEQYWDNLLSSCVSCKPACG
HRSQRTCAAFCKSLNCRKEQGKYYDHLLRDCISCISICGQHPKQCAHFCENKLRSQGNLP
SGVWRSQAGETDARSDNLGQYQGLEPRGSETGPAPLGPKLSSDQLALVYCTLGLCLCAII
CCFLVAVACFLKRRGDVLSSQPSTGLCRLQDKSSHDPATEAGGLACVSPEPVETCSFCFP
ERRAPTQESAGTPDTPGPAAGQDAWGRCAGTGGGLGVVCAPAQDWSPGA
Download sequence
Identical sequences ENSCPOP00000006701 10141.ENSCPOP00000006701 ENSCPOP00000006701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]