SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006807 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006807
Domain Number 1 Region: 48-285,328-406,451-544
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.35e-125
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000027
Further Details:      
 
Domain Number 2 Region: 528-651
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.85e-31
Family Anticodon-binding domain of Class II aaRS 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006807
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00392
Family a tRNA synthase domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006807   Gene: ENSCPOG00000007547   Transcript: ENSCPOT00000007620
Sequence length 665
Comment pep:known scaffold:cavPor3:scaffold_44:6886174:6921107:1 gene:ENSCPOG00000007547 transcript:ENSCPOT00000007620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDLVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQPKDDIVDRSKMEDTLKRRFFY
DQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGH
VDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQEL
GDLFVNYNVKSPSTGNELSPPVPFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEF
NQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKEHPKFQNVADIYLY
LYSAKAQVSGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLVKVGVSPDKLRFRQHME
NEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNV
VQFEPNKGAVGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKD
MVSVKRFQKTLYVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVVAPF
KCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDF
DTVNKTPHTATLRDRDSMRQIRAEVSELPGIVCDLANGSITWADVEARFPVFEGQETGKK
ETIEE
Download sequence
Identical sequences 10141.ENSCPOP00000006807 ENSCPOP00000006807 ENSCPOP00000006807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]