SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006849 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006849
Domain Number 1 Region: 65-104
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000252
Family TNF receptor-like 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006849
Domain Number - Region: 135-158
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0104
Family TNF receptor-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006849   Gene: ENSCPOG00000007596   Transcript: ENSCPOT00000007669
Sequence length 253
Comment pep:known scaffold:cavPor3:scaffold_25:25126637:25136835:1 gene:ENSCPOG00000007596 transcript:ENSCPOT00000007669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSFRSTLVAVLLVASFERTKSVLDSCGKCPAGTFCEKNKDPPCTLCPANSYSSRGGQT
ACDICRKCEGLFRTKKPCSPTSNAECECVPGFRCLGPGCASCHPDCEPGQQFTEDGCEDC
CCGTFNGERGGVCRPWTQCSLSGKTVLVNGTKEKDVVCGPVPSDFPPDTSRPISPRVCAG
PSPQSFSVLLVLTSAMVLLLLLLCVCQHSVIKWSWKRFAYLFKRPFMKPVQTAQMEDACS
YRFPQEEEGECEP
Download sequence
Identical sequences 10141.ENSCPOP00000006849 ENSCPOP00000006849 ENSCPOP00000006849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]