SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006921 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006921
Domain Number 1 Region: 618-997
Classification Level Classification E-value
Superfamily RNI-like 1.57e-73
Family 28-residue LRR 0.00000936
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily DEATH domain 7.3e-22
Family Pyrin domain, PYD 0.008
Further Details:      
 
Domain Number 3 Region: 208-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000647
Family Nucleotide and nucleoside kinases 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006921   Gene: ENSCPOG00000007681   Transcript: ENSCPOT00000007755
Sequence length 1010
Comment pep:novel scaffold:cavPor3:scaffold_1:3921563:3927627:1 gene:ENSCPOG00000007681 transcript:ENSCPOT00000007755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRSMTSARCKLAGYLEDLDHVDFKKFKMYLEDYPPQGGCTPLPRGQTELADSMDLATAL
IDFNGEERAWAMATWIFGAINRRDLQERAKREEPQWGEWVGTQTVSIFTAATCLCHPPFT
DLRLSKEERAYRRHVRSRFHCIEDRNARLGESVNLNKRYTRLQLVREHPSRQERERELLA
MGGGRLRDSPLGPLRLESLFDLDPEDDSPEPVHTVVVQGAAGIGKTILARKLMLDWASGK
LFQDKFDYLFYIHCREVSLATPRSLGDLIASCCPDPSPPMGRIMRKASRILFLMDGFDEL
QGAFDEHAEAQCTDWRVAAPGDALLGSLIRKRLLPEASLLITTRPAALEKLQHLLERPRH
VEILGFSEARRREYFFKYFSGEAQARAALALIQENEVLFAMCFIPLVCWIVCTGLKQCMD
SGESLAQTSKTTTAVYIFFLSCLLQARGSGHENRLSAQLRGLCSLAAAGIWNQKVLFEEC
ELRSHGLQEGAVSAFLRMSLFQKEVDCEKLYSFIHMTFQEFFAAMYYVLEEEDGEGLAGS
CQVLPSRDVAVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKRLSCRVSQQIRVALL
RWIETKATAKKLQAQPSQLELFYCLYEMQEEGFVRRAMGHFPKIEVNLSTRMDHVVSSFC
IRNCHSVKSLSLGFLHNSLRQDQPVLTARAREGGLPGSPSCSLTPSFCQGLFSALSTTWA
LTELDLSDNILGDLGLGALCETLQSPGCGIQRLWLGRCGLSHQCCSDLSSVLSCGRKLAE
LDLSDNPLGDFGASLLCQGLAHPCCTLNKLWLVSCGLTSACCEDLASVLSTSCSLTRLYI
GENALGDTGVSTLCGKAQWQESHLQKLGLVNSGLTFMGCSALASVLRTTRSLTHLYLRGN
ALGDAGLKLLCEGLLHPGCELRMLELDNCSLTSHSCWDLSTVLTSSRSLRKLSLSNNDLG
DLGVTMLCEVLRQGACVLQNLQLNEMYFNYETRHALETLQEEKPELTLVF
Download sequence
Identical sequences 10141.ENSCPOP00000020660 ENSCPOP00000020660 ENSCPOP00000006921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]