SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007014 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007014
Domain Number 1 Region: 42-254
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.28e-82
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 541-759
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-60
Family Ankyrin repeat 0.0000197
Further Details:      
 
Domain Number 3 Region: 250-375
Classification Level Classification E-value
Superfamily E set domains 2.33e-46
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000115
Further Details:      
 
Domain Number 4 Region: 807-888
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000112
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007014   Gene: ENSCPOG00000007789   Transcript: ENSCPOT00000007863
Sequence length 970
Comment pep:novel scaffold:cavPor3:scaffold_43:3383221:3464745:1 gene:ENSCPOG00000007789 transcript:ENSCPOT00000007863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDDDSYLRGHEQMFHLPPLTHAIFNPELFPPEMPLPTVADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNVHLHAHSLVGKHCE
DGVCTVTAGPKDMVVSFANLGILHVTKKKVFETLEARMTDACVRGYNPGLLVHPDLAYLQ
AEGGGGDRQLTDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDA
IYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFG
DFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEE
VQRKRQKLMPNFSDRAFLGWAGHPLPVWGLQAHSPETVGPGLAGDTGEGYGFPHYGFPTY
SGIAFHPGTTKSNAGMKHGTVNTERNQDPEGCDAGENETVLPATEAEEEPAEPSPGEDGV
PLTHAPAEEDKDMGLQDNLFLEKALQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDE
NGDSVLHLAVIHLHAQLVRDLLQVTSGLISEDIINMRNDLYQTPLHLAVITKQEDVVEDL
LQAGADLSLLDRLGNSALHLAAKEGQDKILSVLLKHRKAALLMDQPNGEGLNAIHIAVTS
NSLSCLLLLVAAGADVNAQEQKSGRTALHLAVEQDNVSLAGCLLLEGEAHVDSTTYDGTT
PLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDWDESWERTGEDEGVVPGTTPLDMAAS
WQVFDILNGKPYEPEVVADDPLAQGDMKQLSEEAKLQLYKLLEIPDPDRNWATLAQKLGL
GILNHAFRLSPAPAKTLMDNYEVSGGTVKELLEALAQMGYTEAIEVIQAACCGSGTPSSM
KGTTQAPLLSLSISPQIDELRDQDSICDSGVETSFRKLSFTESLTGGGPLLTLNKGSPEF
GQQGPIEGKI
Download sequence
Identical sequences ENSCPOP00000007014 ENSCPOP00000007014 10141.ENSCPOP00000007014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]