SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007159 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007159
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.09e-41
Family Biotin holoenzyme synthetase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007159   Gene: ENSCPOG00000007955   Transcript: ENSCPOT00000008030
Sequence length 704
Comment pep:known scaffold:cavPor3:scaffold_90:5713447:5864007:1 gene:ENSCPOG00000007955 transcript:ENSCPOT00000008030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRLRMENGLVPQKIVSVYLQDSALQELADQASCGRAAALLPRADLSPETEPTLDGKDS
SEASGDGTSEPGLTEHLHLHLSSCHECLELESSTIESVKFASAEDIPELPYDASGGPQAA
SNGLSQERAGRRGNAVGKAPNILLYVGSSQDAPDQLQQVQALLADCVDTDRYLLYPLPED
SARRDPWLDHCVLLVIATRKPIPEDVHQKFTAYLAQGGKVLSLSSSFLLGDLRMTCKAAL
QSTVQNLVFSKAGGGDLRLSALSSGCVYKDSPEEILGPDRLQGHLENEDKDRVIVQVPFG
DCGGEAILCQVHLELPPSSSVVQTQEEFNLLKSSNVSRYEVLKEILDALGLSCGTQQAPA
LTPLHLLTVAEEIRGPFMQWLGRRVDPGGVIKSSKLALKFVSSYTPEVEITPSSVPVVTD
TEAFSSEHFNLEIYRQNLQTQRLGKIILFAEVTTTTMSLLDGLMFEMPQEMGLIAIAGRQ
TQGKGRGPNAWLSPLGCALSTVLLSIPLRSHLGQRIPFVQHLMSLAIVEAVRSIPEYQDI
NLRVKWPNDIYYGDLMKIGGVLVNSTLMGDTFYILIGFGFNVTNSNPTICINDLIEEYNR
QHGTELKPLRADYVIARAVTLLERLIDTFQDKGPDGVLPLYYKYWVHSGQQVRLGKAEGP
QVWIVGLDDSGYLQVHQDGGEVVTVHPDGNSFDMLRNLVLPKRW
Download sequence
Identical sequences 10141.ENSCPOP00000007159 ENSCPOP00000007159 ENSCPOP00000007159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]