SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007249 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007249
Domain Number 1 Region: 59-275,443-681
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.4e-137
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000284
Further Details:      
 
Domain Number 2 Region: 691-833
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.74e-16
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.002
Further Details:      
 
Domain Number 3 Region: 277-439
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 0.000000015
Family ValRS/IleRS/LeuRS editing domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007249   Gene: ENSCPOG00000008058   Transcript: ENSCPOT00000008133
Sequence length 902
Comment pep:known scaffold:cavPor3:scaffold_7:46494421:46571930:1 gene:ENSCPOG00000008058 transcript:ENSCPOT00000008133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAWPRLGLCASLLPRQLNGGSNVFGWKRKVIPGWTRTIYSATGKWTKEYTVQTRKAVE
KWWHQRIKEQVSKISETDKSKPKFYLLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGM
QVIHPMGWDAFGLPAENAAIERNLHPQSWTQSNIKHMKSQLDQLGLCFSWDREITTCLPD
YYRWTQYLFIKLYEAGLAYQKEALVNWDPVDETVLANEQVDELGRSWRSGAKVEQKFLRQ
WFIRTTAYAKAMQDALAQLPEWYGIKAMQAHWIGDCVGCHLDFELKVDGHDAGEKLAAYT
ATPEAIYGASHVAITSCHSLLQGHSPLRETLRGAQVPGKDCLTPVVAVNLLTRQEVPIVI
LAETDLGGSLDSKIGIPSTSPEDARLAHALGLSYSHVIETLPDGTERLSGSAEFTGLTRR
EAFLALTQKARQLRVGGHVTSDKLKDWLISRQRYWGTPIPIVHCPACGPVPVPLEDLPVT
LPSLTSFTGKGGSPLATASEWVNCTCPRCQGAAKRETDTMDTFVDSSWYYLRYTDPRNPH
SPFARALADFWMPVDLYVGGKEHAVMHLFYARFFSHFCHDQKMVKHREPFHKLLAQGLIK
GQTFRLPSGQYLPREQVDLTGGVPVHSDTREPLVVSWEKMSKSKHNGMDPEEVVAQYGVD
TTRLYLLYAAPPEKDILWDVKTDALPGVLRWQQRLWALVTRFIEARTSRGDPQPTPLSSA
EEAEARKLWEYRNAVIAQVTAHFTEDLSLNSAISQLIGLSNALSQTSAPVLHSAEFEDAL
CALLVMTAPLAPHLASELWAGLALLPHKHCAHYAWDTDLLLQAWPTVDPKFLQQPDVVEM
AVLINNKACGKVPVPQQVAGDHDRVRELVLQSELGARLLQGRSIQKTFLSPRTALINFLV
QE
Download sequence
Identical sequences H0VBG8
XP_003477067.1.53824 XP_005006894.1.53824 10141.ENSCPOP00000007249 ENSCPOP00000007249 ENSCPOP00000007249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]