SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007318 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007318
Domain Number 1 Region: 261-365,466-546
Classification Level Classification E-value
Superfamily HCP-like 0.0000000000915
Family HCP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007318   Gene: ENSCPOG00000008138   Transcript: ENSCPOT00000008213
Sequence length 578
Comment pep:known scaffold:cavPor3:scaffold_112:2754512:2780776:-1 gene:ENSCPOG00000008138 transcript:ENSCPOT00000008213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKGHKDSFYPCERTPSSNLHEALDQCMVALDLFLTNQFSEALSYLKPRTKESMYHSLT
YATILEMQAMMTFDPQDILLAGNMMKEAQSLCQRHRRKSSVTDSFSNLVHRSTMDQFTEE
EIHAEVCYAECLLQRAALTFLQDENMVSFIKGGIKVRNSYQTYKELDSLVQSSQYCKGES
HRHFEGGVKLGVGAFNLTLSMLPTRILRLLEFVGFSGNKDYGLLQLKEGATGHSFRAVLC
VMLLLCYHTFLTFVLGTGNVNISEAEKLLKPYLNRYPKGAIFLFFAGRIEAIKGNIDSAI
RRFEECCEAQQHWKQFHHMCYWELMWCFTYKGQWKMAYFYADLLSKENSWSKATYFYMKA
AYLSMFGKEDYKPFGDDEVELFRAVPGLKLKIAGKSLPTEKFAIRKSRRYLSPNPVSLPI
PALEMMYIWNGYAVIGKQPELTDGMLEIITKAEAVLAQGPENEYSADDECLMKLLKGLCL
KYLGRVQEAEENFRSIAASEKKIKYDHYLIPNALLELALLFMEQGRNEEAIKLLESAKQN
YKNYSMESRTHFRIQAATLQAKTSLENGNRSIVSSVSV
Download sequence
Identical sequences H0VBN0
ENSCPOP00000007318 10141.ENSCPOP00000007318 ENSCPOP00000007318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]