SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007326 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007326
Domain Number 1 Region: 556-1010
Classification Level Classification E-value
Superfamily RNI-like 1.52e-38
Family 28-residue LRR 0.0081
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily DEATH domain 2.07e-18
Family Caspase recruitment domain, CARD 0.0028
Further Details:      
 
Domain Number 3 Region: 133-330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000011
Family Nucleotide and nucleoside kinases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007326   Gene: ENSCPOG00000008148   Transcript: ENSCPOT00000008223
Sequence length 1018
Comment pep:known scaffold:cavPor3:scaffold_18:13645014:13666072:-1 gene:ENSCPOG00000008148 transcript:ENSCPOT00000008223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDFIKENSKILIQRMGMAVIKQIVDELFVWNVLNSEEISIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLEKCDYALFQDLSGQSLFQQLPEGDLDDLAQDLKILYQTPSFLNFYPL
GKDFDIIFNLKSIFTEPVLWRKDQHHHHVEQLTLNGLLETLQNPCIIEGESGKGKTTLLQ
RIAMLWASGTCRTLTKFKFVFFLRLSRAQGGLFETLCDQLLDVPDTLGRQTFKSMLLKLQ
QRVLFLLDGYNEFEPQNCPEIEALIKENHRFKNMVIVTTTTESLRHIRQFGAQIIEVGDM
TENSAQVLIREVLIKELAEGLLLQIKSSRSLRNLMKTPLFVIITCIIQMGENEFHAHTQT
TLFRTFYDLLIHKNKHKHRGATAVDFSRSLEHCGDLALEGVFSHRFDFELEDVSCVNEDV
LVTTGLLCKHTAQRFKPKYKFFHNSFQEYVAGRRLSGLLTSPEPEEVAKGNAYLQKMVCI
SDITSLYSNLLLYTCGSSAAATRAVLRHLTGVCQHGSLDGLSVTRRPLWRQASIQSMNNT
TDQEILKAININSFAECGINLFQESVSKSTLSHEFETFFHGKSLYINSENIPDYLFDFFE
CLPNCASALNLIKLDFYGGALASRDKATAEGSSETYIPNRAVSLFFNWKQEFQTLEVILR
DFSKLNKKDIKYLGKIFSSATSLRLYIKRCAGVAGTLSSVLGSCKNIHSLMVDSSPLTVE
DEQYIASVTNLTTLSIHNLHTQRPPGGLTEGLGNLKNLTKLILGNIEMNEDDAVKLAEGL
TNLKTLCLFRLTHLSDIGEGMDYIVKSLSGEPRDLQEIQLVSCCLTANSVRTLAARNLHN
LVKLSILDLSENYLEKDGNEALCELIGRLSVLEHLAVLMMPWCLDAHVSLTSLLQQLEGV
PQLLKLGMKSWRFTDADIRILGTFFEKNPLKNFQHLDLAENCVSSDGWLGFMGVFENLKQ
LVFFDFSTEGLLPDPALVRKLGHVLSKLTFLQEARLIGWQFDDDDISVIKGAFKIVTA
Download sequence
Identical sequences ENSCPOP00000007326 10141.ENSCPOP00000007326 ENSCPOP00000007326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]