SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007342 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000007342
Domain Number - Region: 41-95
Classification Level Classification E-value
Superfamily DEATH domain 0.000141
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007342   Gene: ENSCPOG00000008165   Transcript: ENSCPOT00000008240
Sequence length 183
Comment pep:known scaffold:cavPor3:scaffold_42:807131:811408:-1 gene:ENSCPOG00000008165 transcript:ENSCPOT00000008240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPDQTYCDRLVQDTPFLTGQGCLSEQQVDRIVLQLNRYYPQVLTNKEAEKFRNPKASLRV
RLCDLLSHLQRSGERHCQEFYRALYIHAQPLHCHLPSRRALQNSDCTELDWGSESRRLSD
RGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLGFSPVIIDRHVSRYLLAFLADDF
RGL
Download sequence
Identical sequences ENSCPOP00000007342 ENSCPOP00000007342 10141.ENSCPOP00000007342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]