SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007483 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007483
Domain Number 1 Region: 7-102,133-239
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-63
Family Calponin-homology domain, CH-domain 0.000083
Further Details:      
 
Domain Number 2 Region: 8018-8173
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 7798-7922
Classification Level Classification E-value
Superfamily Spectrin repeat 4.13e-19
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 8384-8498
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-18
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 3298-3420
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-18
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 1587-1721
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 7 Region: 7041-7194
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 8 Region: 2642-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-16
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 9 Region: 4472-4629
Classification Level Classification E-value
Superfamily Spectrin repeat 1.67e-16
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 5028-5170
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-16
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 11 Region: 3854-3994
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000183
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 12 Region: 7390-7521
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000222
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 13 Region: 2424-2551
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000132
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 14 Region: 6936-7077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000238
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 15 Region: 4254-4410
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000288
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 16 Region: 3024-3140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000432
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 17 Region: 1367-1502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000432
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 18 Region: 520-660
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000182
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 19 Region: 3780-3889
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000236
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 20 Region: 6725-6865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000653
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 21 Region: 3533-3664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000798
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 22 Region: 7926-8036
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000024
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 23 Region: 7265-7383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000202
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 24 Region: 5893-6031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000432
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 25 Region: 8461-8607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000736
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 26 Region: 2796-2913
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000108
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 27 Region: 5695-5772,5883-5929
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000183
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 28 Region: 4923-5021
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000245
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 29 Region: 3138-3247
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000995
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 30 Region: 7706-7812
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000014
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 31 Region: 7480-7599
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000202
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 32 Region: 2318-2437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000461
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 33 Region: 7626-7745
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000654
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 34 Region: 1691-1828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000791
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 35 Region: 2013-2152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000196
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 36 Region: 5542-5652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000276
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 1507-1617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000036
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 38 Region: 1039-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000177
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 39 Region: 2210-2366
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000317
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 40 Region: 5436-5556
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000102
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 41 Region: 1887-2037
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000131
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 42 Region: 3965-4098
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 43 Region: 6343-6448
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000236
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 44 Region: 3447-3557
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000036
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 45 Region: 4171-4298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000461
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 46 Region: 6519-6603
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000054
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 47 Region: 850-976
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000576
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 48 Region: 6037-6154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000528
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 49 Region: 4842-4952
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000563
Family Spectrin repeat 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007483
Domain Number - Region: 6616-6719
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000378
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number - Region: 4650-4741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 5143-5244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000623
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 3640-3764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0121
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 8281-8395
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0142
Family Spectrin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007483   Gene: ENSCPOG00000008325   Transcript: ENSCPOT00000008400
Sequence length 8747
Comment pep:known scaffold:cavPor3:scaffold_41:6571137:6910584:-1 gene:ENSCPOG00000008325 transcript:ENSCPOT00000008400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILQRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGRALSFLE
GRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSLDSVVS
SETTSPPTKRKVATKIQGNAKKALLKWVQCAVGKQTGIEVKDFGRSWRNGVAFHFVIHAI
QPTLVDLEKVKGRSNRENLEDAFAIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLK
HYPDIHSTGTEGQETDEILQVFQSFANSTQNFKREDRLILKEMKIWIEQFERDVTRAQVT
ESNLQDKYQSFKHFRIQYEIKRKQIEHLIQPLTRDGKLSLDQALVKQSWDRLSSRLFDWH
SQLDKSLPAPLGTIGAWLYRAEVALKEEIAVQQAHEETANTIQRKLEQHKDLLQNTDAHK
RAFHEIYQTRSVNGIPVPPDQLEDMAERFQFVSSTSALHLRKMEFLELKYRLLSLLVLAE
SKLKSWIIKYGRRESVELLLQNYISFIENSKFFDQYEVTYQILKQTAEMYIKADGSVEEA
ENVMKFMNETTAQWRNLSVEVRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNKSE
NAKKDFFRNLPHWIQQHTAMNDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQY
ARADEMDRMKKEYTDYVTTLSDFAAEAHKKFAEPLEVSFINVQLLIQDLEDIEQRIPVMD
AQYKMITKTAHLIAKESTQEEANEMFSNMSRLKEQLAKVKDDCSPLLYQSQQLLIPLEEL
EKQMTSLYDTLGKINEIITILEHEAQSSALFKQKHQELLACQESCKKTLTLIEKGSQSVQ
KFVTLSSVLKHFDQTKLQRQIADVHVAFQNMVKKTGDWKKHVETNSRLMKKFEESRAELE
KVLRVAQEGLEEKGDPEELLRRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEA
VRKLHKQWKDLQGEAPYHLLHLKIAAEKNRFLASVEECRAELNRETNLVPQEGSEKIIKE
HRIFFSDKGPHHLCEKRLQLIEELCMKLSARDPVRDTPGTCHTALKELKAAINATYAKLV
EDPDKWKDYTSSFLSSPSWISAKETQLKGIKDAAIDTANHSEIKCTVEEIRHDVTTRGEN
LSWLKSRLKILMEVSSENEAQQRGDELAKLSSSFKELTTLLSEVEKMINNFGECVQYKEI
VRSSLEELISGSQEAKDEAEKILDTDNLFEAQQLLLHHQQKTKMISAKKRDLQQQMGQTQ
QGAGGLADPGREELQKLERTLASVEHNRERQERRIQVTLRKWERFETNKETVVRYLFQTG
SSHERFLSFSSLESLSSELEQTKEFSKRTENIAIQAENLVKEASEIPLGPKNKQLLQQQA
KSIKEQVTKLEDTLEEDIKTMEMVKNKWDHFGSNFETLSIWITEKEKELNALEASSSAMD
MQISQIKVIIQEIENKISSITGLEEQAQSFAQFITTGESARIKAKLTQIRRYWEELREHA
QCLEGTILGHLSQQQKFEENLRKIQQSVSEFEDKLADPIKMCSSATETYKVLQEHMDLCQ
ALESLSSTVTALSASSRKVVSRDSCIQEATALQQRYEGTLRRVKDRQTLLENLLAHWQRL
EKELSSFLTWLERCEAITSSPEVDISADRVKVESELQLIQALQNEAISQSSSYSRLLQLK
ESLFSIASKDDVKMITLHLEQLDERWRNLPQIISKRINFLQSVVAEHQQFDELLLSFSTW
IKQFLSELQMTSEISIMDHQVALSQHKDHAAEIVNKKRELQSLQGHLAKLGSLGRPEDLH
LLQGKAEDCFQLLEEATQVVERRQLALSQLTEFVQRQASLSGALHQLKQAVETTSSMTKK
QSDLLEKDLNDAIQDVKTLESTAIGLDGLLTKAQYHLRSRRAEHRTSCRAVADQLSLELE
RIQSLLGSKQSEADALALLKKAFQEQREGLLRRIEDIEERADKEGLKEPTRQALQQRLRV
FNQLEDELNSHEHELCWLKDKAKQIAQKDVAFAPEVDKVINRLEVTWNDTKRLIHENQGQ
CCGLIDLTREYQNLKSTVSKVLENASSVIVIKTTVKDREDLKWALSKLETAKNEMNCKQK
ELDSFTSKGKHLLAELKKIHSSDFTLVKTDMESTVDKWLDVSEKIEENMEKLKISLSIWE
DVLSSKDEIDGWSNSSLPQLAENISNLNDSLRTEEFLKEFESEVKNKALKLEELHSKIND
LKELTKNPETPPDLQFIEADLRQKLEHAKEVTEEAKGTLKDFTAQSINVEKFINDRTEWL
MKVEESLMSCAQAKTCKGLKKVKDIAKKRAQSQQSNISSTQENLNSLCRKYHSAELESLG
RAMTGLIKKHEAVSQLCFKTQASLQESLEKHFNEDSMQEFQEWFSGAKAAAKESSHRTGD
SKVLETKLHDLQNILDSVSDGQSKLDAVTQEGQTLYAHLSKQMVGSIQEQITKANEEFQA
FLKQCLKDKQALQDCASELGSFEDQHRKLNLWIHEMEERLNTENLGESKQHLPEKKNEVH
KVEMFLGELLAARESLDKLSQRGQLLSEEGHGPGQGGRLGSQLLTSYQNLLRMTKERLRG
CQLALQEHEALEEALQDMWSQVREVQDRLACAESTLGSKETLERRLSQIQDILLMKGEGE
VKLNMAIGKGEQAIRSSSKEGQKAIQAQLQTLKNTWADVVSTSVHAQSTLESVLSQWNDY
LERKHQLEQWMESVDEKLEHPLQLQPGLKEKFSLLDHFQAIMSEADDHTGALYRLCAKSR
ELYEKTQDESFKETAQEELKTQFHDIVTVAKEKMRKVEEIVKDHLMYLDAVHEFTDWLHS
AKEELQRWSDMSGDSSATQKKLLKIKELIDSRELGAGRLARVESLAPGVKQHTAASGCEL
LHTEMQALRADWKQWEDSIFRTQSSLEDLVSQMALSEQEFSGQVAQLEQALGQFGALLKT
WTQQLALLEGKNTDTELVESWHAGQEILDALQKAEPTTEDLKSQLNELCRFSRDLSTYSG
KVSGLIKEYNCLCLQASKGCQSKEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNIT
EVSASLQKIQEFLSESENGQHKLNTMLSKGELLTSLLTKEKAKSIQAKVEAAKEDWKNFH
SNLHQKESALENLKIQMKDFEVSADPVQNWLSKTEKLVHESSNRLYDLPAKRREQQKLQS
VLEEIHCYEHQLNRLKEKAQQLWEGQAASKSFMHRVSQLSAQYLALSNSTKEKVSRLDRI
VAEHNQFSLGIKELQDWMTDAVHTLDSYCHPTSDKSVLDSRILKLEALLSVKQEKEIQMK
MIVTRGEYVLQNTSPEGIPAIQQQLQGVKDMWASLLSAAIRCKSQLEGALSKWTSYQDDV
RQFSGWMDSVEANLSDSERQCAELREKVTALGKAKLLNEEVLSHRSLLETIEVKGASMTE
HYVTQLELQDLQERYLAIRERAKEAVTKSEKLVRLHQEYQRDLKTFEVWLGQEQEKLDQY
SVLEGDAHIHETTLRDLQELQMRCAEGQALLNSVLHTREDVIVSGIPLAEDRVLESLRQD
WQAYQHQLSETRTQFNNIVNKLRLMEQKFQEVDEWLKKTEEKVSLRTGRQSNRAAKEMQL
HQMKKWREEVTAHKDEVEEVGAKAQEILDESHVNSRMGCQATQLTSRYQALLLQVLEQIK
FLEEEIQSLEESELSLSSYSDWYSSTHKNFKNVATKIEKVDKKVMEKKLKTLEVLLKDMD
KGHSLLKSAREKGEKAAKYLEEGEAEMLRKDIHDQVEKLEELTGTMRKEHVTVEKGLHLA
KEFSDKCKALTRWIAEYQEILQVPEEPKMELYEKKAQLSKYKSLQQTVLSHEPAVNSVRE
KGEALLDLIQDVTLKDKIDKLQRDYQDLCSMGKEHVLCLEAKVKDHEDYNSELQEVEKWL
LQMSGRLVAPDLLETSSLETITQQLAHHKAMMEEIAGFEDRLNDLKVKGDTLLGQCADHL
QEKLKQSVRAHLQGTRDSYSAICSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSTVQPD
LKPSPQPPLSRAEAVKQVKHFRALQEQARTYLDLLCSMCDLSNSSVKTTAKDIQQTEQMI
EQRLAQAQNLTQGWEEIKHLKAELWIYLQDADQQLQNMKRRHSELELNIAQNMVAQVKDF
AKQLQCKQASMSTILEKVNKLTKKQESPEHKEISHLNDQWLDLCLQSDKLCSQREQDLQR
TREYHDRMNVVEAFLEKFTTEWDNLARSDAESTAVHLEALKKLALALQDRKYAIEDLKDQ
KQKMIEHLNLDDKELVKEQTSHFEQRWFQLESLVKGKIQVSVTNLEELNVVQSKFQELME
WAEEQQPNIAEALKQSPPPDMVQSLLMDHLAICSELEAKQLLLKSLTKDADRVMADLGLN
ERKVIQKVLCDAQRHVNCLSDLVGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMF
REHICLLPDDVSKQVKTCKSAQASLKTYQNEVTGLWAQGRELMKGVTEQEKGEVLGKLQE
LQSVYDSVLQKCSHRLQELEKNLVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESTEL
DTQLDKYQHILEQSPEYENLLLTLQRTGQAMLPSLNEVDHSYLSEKLNALPQQFNVIVAL
AKDKFYKVQETMLARKEYASLIALTTQALSELEDQFLKMRKVPTDLAVDEAVSLQDNCKA
LLGEVVALGEAVDELNQKKESFRSTGQPWQPDKMLHLVTLYHRLKRQAEQRVGLLEDTTS
SYKEHLKMCQQLKSQLEAVKMEQSKVNEETLPAEEKLKMYHSLAGSLQDSGILLKRVALH
VEDIALLLDPSAYEKAKHQVQEWQEELTLLTSSIGEMVTECEGRMVQSRDFQTEMSHSLD
WLRRVKAELSGPICLDLSLQDIQQEIRKIQIQQEEVQSSLRIMSALSNKEKEKFTKAKEL
ISADLEHTLAELAELDGDIQEALRARQATLTEIYSQCQRYYQVFQAANDWLEDAQEMLQL
AGNGLDVESAEENLKSHKEFFSTEDQFHSNLEELQALVTRLDPLIKSTGREDLTQKMTSL
EERSQRITQDSCAQLDLLQRCTVQWQDYQKAREEVIELMNDAEKKLSAFSLLKTSSSHEA
EEKLSQHKALVSEVDSFHDKVVALEEKASQLEKSGNDASKATLNRSTTTVWQRWTRLRAV
AQDQEKILEDAVDEWKGLNNKIKKATEIIDQLQDKLPGSSAEKASKAELLSLLEYHDTCV
LELDQQQLALGVLQQQALSMLQDGALPSGEEPPTLQEITAMQDRCLNMQEKVKSNGKLVR
QELQEREVVETQINSVKSWVQETKEYLGNPTIEVDAQLQELQILLTEATNHRQNIEKLAE
EQKNKYLGLCTIVPSEISLQLAEVALDLKIYDQIQEKVKEIEQSKTMSQEFSRQIQQVAK
DLTTILTKLKAKTDNLVQAKTDQKVLGEELDGCNSRLMELDAAVQKFSEQHSHLSKPLAK
KIGKLTELQQQTVRQAENRLSKLNQAASHLEEYNEMLELILKWIEKAKVLVHGNIAWNSA
NQLREQYISHQALLEESEEIYSDLEAMSEKLQCLTSVYYTEKMSQQVTELGRETEELRQV
IKIRMQSLQDAAKDMKKFEAELKNLQMALEQAQTTLTSPEIGRLSLKEQLSHRQHLLSEM
ESLKPKVQAVQLCQSALRIPEDVVASLPLCHAALHLQEEASRLQHSAIQQCNLMQEAVVQ
YEQYEQEMKHLQQLIESAHREIEDKPVATSNIQELQAQITRHEELAQKIKGYQEQIASLN
SKCKMLTMKAKHATMLLTVTEVEGLAEGTEDLDRELLPTPSAHPSVVMMTAGRCHTLLSP
VTEESGEEGTNSEISSPPACRSPSPVANTEASVNQDIAYYQALSAERLQTDAARIHPSTS
ASQEFYEPGLEPSATAKLGDLQRSWETLKNVISEKQRTLYEALERQQRYQDSLQSISTKM
ETIEMKLSESLKPGRSPESQMAEHQALMDEILMVQDEINALQASLAEEMVFEARESDPAE
QLALQSTLTVLAERMSTIRMKAAGKRQLLEEKLNDQLEEQRHKQALQRYLCEADELDHWL
LSTKANLDVALGAPTEPMDMEAQLVDCQNMLVEIEQKVVALSELSLHNENLLLEGKAHTK
DEAEHLAGKLRTLKGSLLELQRALRDRQLHIQQGTSQEKEESDADPTAAQSPGLQEWLAQ
VRTTRTHQRQNSLQQQKELEQELAEQKSLLQSVASRGEEILTQHSAAEAASGLGEKPDVL
SQELGQEGEKSTAEDQMRMKWESLHQEFSTKQKLLQSVLEQEQEQVLYSRPNRLLSGVPL
YKGEGQTQDKSAVTSLLDGLNQAFEEVSSQDAGAKNQNMHLEQKLYDGVSATSTWLDDVE
ERLFVATALLPEETETCLFNQEALAKDIKEMSEEVDKNKNLFSQTFPENGDNRDVIEDTL
ECLLGRLSLLDSVVDQRCHQMKERLQQILSFQNDMKVLFSSLADNKYIILQKLANVFEQP
VAEQIEAIQQAEEGLKELDAGITELKRRGDKLQIEQPSLQELSKLQDMYDELVMTIGSRR
SGLNQNLVLKSQYERALQDLADLLETGGEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLE
SHMILTEMLFRKIISFAVPKETQCHADLMAQASTVLKRAHKRGVELEYILETWSRLDEDL
QELSRQLEVVENSIPSVGLVEESEDRLIERTSLYQHLKSSLNEYQPKLYQVLEDGKRLLI
SVSCSDLESQLNHLGENWLSNTNKVSKELHRLETILKHWTRYQSESADLIHWLQSAKDRL
VFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSALKSSVLSTGNQLLRLKKVDTAPLR
SELSHIDSQWMDILTNIPAIQEKLHQLQMDKLPSRHAISEVMSWISLMESVIQKDEEDIK
NAIGYKAIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGA
MNKSWQILQGLVTEKIQLLEGLLESWSEYENNVQCLKTWFETQEERLKQQHQIGDQASVQ
NALKDCQQDLEDLIKAKEKEVEKIEQNGLALIQNKKEEVSATVLCTLQELNRTWANLEHM
AGQLKIRLKSVLDQWDQHKVALEEMNSHLMEARYSLSRFRLLTGSFEAVQVQVDNLQNLH
DDLEKQERSLEKFGAVTNQLLKECHPPVTETLTNTLKDINMRWNNLLEEIAEQLHWSKAL
LQLWQRFKDYSSQCASTVQQQEERTNELLKAATNKDIADNEVATWIQDCNDLRKGLGTIK
DSLFILHELGEQLKQQVDASAAEAIQSDQLSLSQHLCTLEQALCKQQTMLQAGVVDFETF
AKSLEALEAWIVEAEEVLQGQDPTHSSDLSTIQERMEELKGQMLKFSSMAPDLDRLNELG
YRLPLNDKEIKRMQNLNCLWSLTSSQTTERFSKLQSFLLQHQTFLEKCETWMEFLIQTEQ
KLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKL
TLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYRAMAEKLRKWLVEVSYLPMNGLGSVPVPL
QQVRTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSTDSAAEAALQAELTEIQEKWKSA
SLHLEEQKKKLAFLLKDWEKCEKGVADSLEKLKNFKRKLSQPLPDHHEELHAEQMRCKEL
ENAVGSWTDDLTELTLLRGTLAAYISADDISILNERIELLQRQWEELCHQVSLRRQQVGE
RLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLKKDYQEEIAVAQENKIQLQ
QMGERLAKASHETKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSNL
RTWLAHIESELAKPIAYDSCDSEEIQRKLNEQQELQKDIEKHSTGVASVLNLCEVLLHDC
DACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKI
SERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHETLTQLELINKQYRRLARENRTDSACS
LKQMVHDGNQRWDNLQKRVTSILRRLKHFISQREEFETARDSILVWLTEMDLQLTNIEHF
SECDVQAKIKQLKAFQQEISLNHSKIEQIIAQGEQLIEKSEPLDAAVIEEELDELRRYCQ
EVFGRVERYHKKLIRLPLPDDEHDLSDRELELDDSAALSDLHWQDSSVDGVRSERSGRDT
PASVDSIPLEWDHDYDLSRDLESAVSRTLQSEDEEGQEEKDFYLRGAVGLSVGTTGHHSA
LESQIQQLDKALDDSRFQLQQTENVLRSRTPTGPELDSSYKGYMKLLGECSGSIDSVRKL
EHKLKEEEENFPGFVNLNSTEMQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNADLN
NIWTWLGETEEELERLQRLELSTDIQTIEHQIKKLKELQKAVDHRKAIILSINLCSSEFT
QADSKESQDLRDRLSQMNGRWDRVCSLLEDWRALLQDALMQCQDFHEMSHGLLLMLENID
RRKNEIIPIDSHLDTEILQDYHKQLMQIRRELSESQLKVTSLQDMSCQLLVNAEGTDCLE
AKEKVHVIGNRLKLLLKEVSRHIKDLEKLLDMSSSQQDLSSWSSADELDTSGSVSPTSGR
STPNKQKPPRGKCSVSQPGPSVSSPNSRSTKGGSDSSLSELRPARSGRAFLFRVLRAAFP
LQLLLLLLVGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences 10141.ENSCPOP00000007483 ENSCPOP00000007483 ENSCPOP00000007483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]