SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007596 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007596
Domain Number 1 Region: 26-81
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000241
Family TNF receptor-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007596
Domain Number - Region: 80-122
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000306
Family TNF receptor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007596   Gene: ENSCPOG00000008449   Transcript: ENSCPOT00000008526
Sequence length 247
Comment pep:known scaffold:cavPor3:scaffold_107:752621:757737:-1 gene:ENSCPOG00000008449 transcript:ENSCPOT00000008526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWPPPGWLCVLGTLLGLSTALDPRSCPERHYRSAEKLCCQMCRPGTFLVKDCDQHSTAA
QCDPCKPGLSFSPDYHSRRHCESCRHCQECVSTRNCNVTTNTQCACPQDWQCRDTECTEC
DPLPGLTILPAAAQDAHPLPDHPAYTKTPPGLVSFLPNPHSQRESRAQGPLCSSDCVRVF
MIFSGMLLVFTLGGALFLYQQRRCQSNKGANPEESTEPCPYSCPREEEGHTVPIQEDHQK
PELPSYP
Download sequence
Identical sequences ENSCPOP00000007596 ENSCPOP00000007596 10141.ENSCPOP00000007596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]