SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007615 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007615
Domain Number 1 Region: 182-490
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.1e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000231
Further Details:      
 
Domain Number 2 Region: 58-179
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000000000288
Family Seryl-tRNA synthetase (SerRS) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007615   Gene: ENSCPOG00000008471   Transcript: ENSCPOT00000008548
Sequence length 524
Comment pep:known scaffold:cavPor3:scaffold_52:12426960:12436947:-1 gene:ENSCPOG00000008471 transcript:ENSCPOT00000008548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVPRRLWPLLSRPGLRSRGDSVYNQNPWRNFATEKRSPNLLYQHAREGYSALPHLDM
ELLCACPEKVARALELRKGELRPADLPGIISTWQELRQLQEQIRSLEAEKDTVAEAVRAL
LVNQDHSQVQQDPQYQALRTRGREIRKQLVLLYPREDQLEEQFYLQALRLPNQTHPDVPV
GNESQARVLQVVGDKPAFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVNFTLSKLVRRGFTPMTVPDLLRGAVFEGCGMTPNASPSQVYNIDPSRFEDLNLAGTA
EVGLAGYFMDHSVAFRDLPVRTVCSSTCYRPETDTGREPWGLYRVHHFTKVEMFGVTGPG
LEQSSQLLEEFLALQVEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT
SASNCTDFQSRRLHIMFQTETGELCFAHTVNATACAVPRVLIALLESNQQRDGSVLVPPA
LQPYLGTDRITAPTHVPLQYIGPNQPQKPSLPPPAPICGLSLPP
Download sequence
Identical sequences 10141.ENSCPOP00000007615 ENSCPOP00000007615 ENSCPOP00000007615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]