SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007817 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007817
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.74e-43
Family Calponin-homology domain, CH-domain 0.000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007817   Gene: ENSCPOG00000008708   Transcript: ENSCPOT00000008786
Sequence length 201
Comment pep:known scaffold:cavPor3:scaffold_19:30747900:30749252:-1 gene:ENSCPOG00000008708 transcript:ENSCPOT00000008786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIMQCGSDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEGYGVTKTDMFQTVDLFEG
KDLAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences A0A286XLN5
ENSCPOP00000007817 10141.ENSCPOP00000007817 ENSCPOP00000007817 XP_003472856.1.53824 XP_005378258.1.28644 XP_005378259.1.28644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]