SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007924 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007924
Domain Number 1 Region: 278-462
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.5e-52
Family Nucleotide and nucleoside kinases 0.00000754
Further Details:      
 
Domain Number 2 Region: 137-269
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-33
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 67-154
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-19
Family PDZ domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007924   Gene: ENSCPOG00000008826   Transcript: ENSCPOT00000008905
Sequence length 466
Comment pep:known scaffold:cavPor3:scaffold_148:1060169:1080633:1 gene:ENSCPOG00000008826 transcript:ENSCPOT00000008905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLKSSESEGGGGMRTALSDLYLEHLLQKRSRPEAVSSQLNAVTEDMYTNGSAAPGSPAQ
AKGQEVRKVRLIQFEKITEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEI
NGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDSLIPCK
EAGLKFVTGDIIQIINKDDSNWWQGRVEGSCKESAGLIPSPELQEWRVASVAQSAPSEAP
SCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKN
ALLSQNPEKFVYPAPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFG
TKFETVHQIHKQDKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGAQTEALQQLQKDSE
AIRSQYAHYFDLSLVNNGVEETLQKLQEAFEQACSSPQWVPISWVY
Download sequence
Identical sequences H0VD78
ENSCPOP00000007924 XP_003462175.1.53824 ENSCPOP00000007924 10141.ENSCPOP00000007924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]