SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007947 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007947
Domain Number 1 Region: 302-584
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.83e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 125-299
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00022
Further Details:      
 
Domain Number 3 Region: 586-694
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.28e-27
Family Anticodon-binding domain of Class II aaRS 0.0014
Further Details:      
 
Domain Number 4 Region: 63-122
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000085
Family TGS domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007947   Gene: ENSCPOG00000008850   Transcript: ENSCPOT00000008930
Sequence length 703
Comment pep:known scaffold:cavPor3:scaffold_10:47564752:47625598:-1 gene:ENSCPOG00000008850 transcript:ENSCPOT00000008930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPSPIQSQEKDTKKQKLKENGFDGEVKQPDFIKERLKLFETLKKDHQHLLSIHEKKENAS
TVITVRMVDGKTVEGEVWETTPYQVAAEISQELAENTVIAKVNGELWDLDRPLEGDSALE
LLMFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFMEDRAVSSTELA
ALENICKTIIKEKQPFERLELSKETLLDMFKYNKFKCRILKEKVNTPTTTVYRCGPLIDL
CKGPHVRHTGKIKSIKIFKNSSAYWESNPEMETLQRIYGISFPANKMMRSWQKFQEEAKN
RDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLMDFIREEYHNRNFTEVLSPNVYNS
KLWETSGHWQHYNENMFTFDIEKDTFALKPMNCPGHCLMFAHRPRSWREMPVRFADFGVL
HRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIGEEIKACLQFLQSVYSTFGFSFQLNLST
RPEDFLGEQPVWDEAEKQLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCAT
IQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSLERMIAILSEHYGGKWPFWLSPRQ
VMVIPVGPTCEKYALQVSSEFFEEGFMADTDLDDSCTLNKKIRNAQLAQYNFILVVGEKE
KINNAVNVRTRDNKIHGEISVTSVIDKLKNLKKSRTLNAEEEF
Download sequence
Identical sequences ENSCPOP00000007947 ENSCPOP00000007947 10141.ENSCPOP00000007947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]