SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008059 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008059
Domain Number 1 Region: 580-660,792-1012
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.25e-64
Family Protein kinases, catalytic subunit 0.00049
Further Details:      
 
Domain Number 2 Region: 1057-1384
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0037
Further Details:      
 
Domain Number 3 Region: 337-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-37
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 
Domain Number 4 Region: 17-144
Classification Level Classification E-value
Superfamily UBC-like 3.96e-36
Family RWD domain 0.00000104
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008059
Domain Number - Region: 1390-1490
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.002
Family Anticodon-binding domain of Class II aaRS 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008059   Gene: ENSCPOG00000008969   Transcript: ENSCPOT00000009051
Sequence length 1645
Comment pep:known scaffold:cavPor3:scaffold_10:25632450:25742885:1 gene:ENSCPOG00000008969 transcript:ENSCPOT00000009051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRGAPGRGPDEPQESYPQRQDHELQALEAIYGSDFQDLRPDARGRVTEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNEIVNLLKSRLEELARKHCGE
VMIFELADHVQSFLIEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIE
EKKNNFVPDTETFQLTIQQERLEIASLSNQDQSSRKDPGGNRTLASIHGGSPDFVGNGKY
RANSSGRSRRERQYSVCSSEDSPGSCEILYFSMGSPDQLMVHKGRCIGSDEQLGKLVYNA
LETATGSFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGAETEFNSLVKLSHPNVV
RYFAMNSKEQDDSIVVDILVEHVSGVSLAAHLSHSGPIPMHQLRKYTAQLLSGLDYLHSN
SVVHKVLSASNVLVDAKGTIKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKG
DVWRLGLLLLSLSQGQECEEYPVTIPGDLPADFQDFLRKCVCLDDKERWSPQQLLKHSFI
NPQPKMPLVEQSPEDSGGQDYAETVIPRNQLPSSSSFSETQRQFSRYFIEFEELQLLGKG
AFGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERH
ERPAGPGTPPPDSGPPAPSGCATQGRPAEDCEPDSVEAAAPPPILSSSVEWSTSAERSAT
AARFPGAGPGSSKDEHGGVFSQSFLPASDSESDIIFANEDENSKSENQNEDCNGKGSCQE
SELSVMTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTIRLWRLFREILDGLAYIHEKGMI
HRDLKPVNIFLDSDDHVKIGDFGLATDHLTFSADSKQDDQAGDHLIKSDSSGRLTGMVGT
ALYVSPEVQGSTKSTYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPDSPKFPE
DFDDGDHTKQKSVISWLLSHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLANVDG
KAYRTMMAQLFSQRISLAIDYTYDSDILKGNFSIRTAKIQQHVCETIIRIFKKHGAVQLC
TPLLLPRNRQIYEHNEAAVFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIERVFR
PRKLDRFHPKELLECAFDIVTSTTNCSLPTAETIYTIYEIIQEFPALQERNYSIYLNHTM
LLKAVLLHCGIPEDKLSQVYVILYDAMTEKLTRREVEAKFCNLSLSSNSLCRLYKFIEQK
GDLQDLTPIINSLIKQKTGVAQLVKYGLKDLEEVVGLLKKLGVKLQVLINLGLVYKVQQH
SGIIFQFVAFIRRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDKIFAA
VLNMEEPVTVSSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQEYCR
HHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVVQKLRTKVSDERSIREAS
DNLAVQNLKGSFSNASGLFEIHGATVVPIVSVIAPEKLSASTRRRYEIQVQTRLQTTLAN
LHQKSSEIEILAVDLPKETILQFLSLEWDADEQTFNTTVKQLLSRLPKQRYLKSVCDEIY
NIKVEKKVSVLFLYSYKDDYYRILF
Download sequence
Identical sequences ENSCPOP00000008059 10141.ENSCPOP00000008059 ENSCPOP00000008059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]